KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4898Help
Entry
Dmel_CG4898       CDS       T00030                                 

Gene name
Tm1
Definition
Tropomyosin 1
Orthology
K10373  
tropomyosin 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dmel_CG4898 (Tm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:88E12-88E13
AA seq 285 aa AA seqDB search
MDAIKKKMQAMKVDKDGALERALVCEQEARDANTRAEKAEEEARQLQKKIQTVENELDQT
QEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAA
DESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSE
EKVELSESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAE
FAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELILKE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcaagcgatgaaagtcgacaaggacggagctctggag
cgcgctctcgtctgcgagcaggaggcacgcgatgctaacacccgcgccgagaaggccgag
gaggaggctcgccagctgcagaagaagatccagaccgttgagaacgagctggatcagacc
caggaagccctgaccctggtcaccggcaagctggaggagaagaacaaggctctgcagaac
gccgaatccgaggttgccgctctgaaccgtcgcatccagttgctcgaagaagacttggag
cgctctgaggagcgtctgggctccgccacagccaagctgtcggaagcctctcaggccgcc
gatgagagcgaacggatacgaaaagcgcttgagaatcgcacaaatatggaagatgacaaa
gtagctctcttggagaaccagttagcgcaagcaaaattaattgcagaagaagctgataag
aaatacgaagaggtggccagaaaactcgtgctcatggaacaggatctggagcgttccgag
gagaaggtcgagctcagcgaaagcaaaattgtggagcttgaggaggagctgcgcgtggtt
ggcaacaacctgaagtccctggaagtctctgaggagaaggccaaccaacgtgaggaggag
tacaagaaccagatcaagaccctcaacacccgtctaaaggaggctgaggctcgtgctgag
ttcgctgaacgctccgttcagaaattgcagaaggaagtcgacaggctcgaagacgacctc
gtcctggagaaggagcgctacaaggacatcggagacgatctcgacaccgccttcgtcgag
ctcatcctcaaggaataa

DBGET integrated database retrieval system