KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4934Help
Entry
Dmel_CG4934       CDS       T00030                                 

Gene name
brn
Definition
brainiac (EC:2.4.1.-)
Orthology
K02175  
putative enzyme (brainiac)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG4934 (brn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:4A5-4A5; X:1-5.9 cM
AA seq 325 aa AA seqDB search
MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKF
AYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGT
AEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYV
SAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAF
ILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSYSSV
IASHEFGDPEEMTRVWNECRSANYA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtaaacaccgcaaactgctgctgcgctgcctcctggtgctgcccctcatcctt
ctggtggactattgcggcctgctgacccacctgcacgagctgaacttcgagcggcacttt
cactacccgctgaacgatgacactggatctgggtccgcatcctctggactggacaagttc
gcctacctgcgagtgccctcgttcacggcagaggtgccggttgaccagcctgcgcggctc
acgatgctcataaagagcgcggtgggcaattcgcgacgtcgggaggccattcgccggact
tggggctacgagggtcgattctcagacgtccatctgcgtcgcgtgttcctgctgggcacg
gccgaggatagtgagaaagacgtggcttgggagtcccgcgagcatggcgacattctgcag
gcggagttcacggacgcctacttcaacaacacgctgaaaaccatgctgggtatgcgctgg
gctagcgatcagttcaatcgcagcgagttctatcttttcgtggacgacgactactatgtt
tcggccaagaacgtgctcaagtttctgggcagggggcgtcagagccaccagccggagttg
ctgttcgccgggcacgtgtttcagacatccccgctccgccacaagttcagcaagtggtac
gtttcgttggaggaataccccttcgatcggtggccaccgtacgtgaccgccggcgcgttc
attctgtcgcagaaggcactgcgccagctgtatgccgccagcgttcacctgccgctcttc
cggttcgacgacgtctacctgggcatagtggccttgaaagcgggcatttcccttcagcac
tgcgacgacttccgcttccatcggccggcgtacaaaggtccggacagctatagttcggtg
atagcctcgcacgaattcggcgatcccgaggagatgacgcgggtatggaacgagtgccga
tccgccaattacgcgtag

DBGET integrated database retrieval system