KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4976Help
Entry
Dmel_CG4976       CDS       T00030                                 

Gene name
NSD
Definition
(RefSeq) nuclear receptor binding SET domain protein, isoform A
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG4976 (NSD)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmel_CG4976 (NSD)
Chromosome [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmel_CG4976 (NSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1427 aa AA seqDB search
MKLSTDAHSEIEGDAAHGNVLCNSASDSLTATDEVAAGNDESVATEGDDVEIPRDTNNST
PVRLLDKPGQNPVQNGAQPAAEESELESQRQTPVQKQQQQRVSMVNRKRDLINLQSALSP
KYIGYANANSPTPLSDSDDTIRTTRRRVNQAAALNNSSAGETLAHDNASPRTPGGGGGGG
GDDSANQLLSKTYMSPIEKLLIKNGASSPNSTGFEAGSEDLGIRPIVRKHVKRKMKRVPK
AKVTLELDEKNQQEVDEKSVKTEPIDEEVDRTDEAPTQEAQTTAISIKSETEAEHKAAVD
VHIKQEDTIRLDIVNNPVESTSIVITEEPKDLEKSTEELAFALPLASSTEVDLKSPPDLS
STALATSIKSPSSVSIDSAKGLSIVTDPGWPTYQVGDLFWGKVFSYCFWPCMVCPDPLGQ
IVGNMPSHPQRSSLDNANVPIQVHVRFFADNGRRNWIKPENLLTFAGLKAFDDMREELRI
KHGPKSAKYRQMVPKRTKVVIWRQAIEEAQAMTQIPYSDRLEKFYQTYENVVTLNRQKRK
RTKYMMQDTSDVGSSLYDSTDNLHNKQGTQLLAVKRERSESPFSPAFSPVKSKNEKRAKR
RKLSNGTEADTGSNSMAVTPSQTETTVDSSAYENPEFRQLLSAVMEYVMMNRSDEKVEKV
LLSVVSNIWSLKQIQLRELERDLASGEIEEPLGSSVVGRGSGVGTIKRLSNRLMTMMVRR
SMTPVVTPSTTPAPSEPDRRLSEPPKTKKPVNRPIEEVIEDILQLDSKYLFRGLSREPIC
KYCYQAGSDLVRCSRTCSSWLHADCLERKVTGAPMPKIGSRKALVIPPTSKSPSPDEDHV
TADAKEVVAVGTSLVCHECNVGEPEGCVICHQVESPAVPSTPRKEDSSSHTPIEDKLLTC
SQPMCGKRFHTSCCKYWPQASSSKHSARCPRHVCHTCVSDDPSGKFQQLGSSKLAKCVRC
PATYHQLSKCIPAGTQMLNTTNIICPRHNIAKADAHVNVLWCYICVKGGELVCCETCPIA
VHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSNILKK
AHGENDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFRNYTTGVEEASRFLPI
IKARRQEQDMERQSGNKLHPPPYVKIKTNKAVPPLRFSQNLEDLSTCNCLPVDEHPCGPE
AGCLNRMLFNECNPEYCKAGSLCENRMFEQRKSPRLEVVYMNERGFGLVNREPIAVGDFV
IEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCE
TQKWTVNCIHRVGIFAIKDIPVNSELTFNYLWDDLMNNSKKACFCGAKRCSGEIGGKLKD
DAVKAHAKLKQMRRAKASAVRIHVKPKKTPKVKHISADDEPMDAKDE
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagcacggacgcgcactccgagatcgagggcgacgctgcccacggcaatgtg
ctgtgcaactccgcgtccgattccctgaccgccaccgacgaagtggctgcgggcaacgac
gagtcggtggccaccgaaggcgatgatgtcgaaattccgagggacaccaacaacagcact
ccggttcgactgctggacaagcccggccaaaacccggtgcagaacggcgcacagcccgcg
gcggaggagtcggagctggagagtcagcggcagacgccagtccaaaaacagcaacaacag
cgtgtgtccatggtgaacaggaaacgagatcttatcaacttgcagtcggcgctgagcccc
aaatatattggctatgccaatgccaactcacccacgccgctttccgattccgatgacaca
atacgcacgacgaggcgacgcgttaaccaagcggcggctttaaataacagcagtgctggc
gagaccctggcccatgataatgcgtcaccaaggacccccgggggaggaggaggaggtggt
ggagatgatagcgctaatcagctgctcagcaagacctacatgagccccatcgagaagctg
ctaatcaaaaacggcgctagttcgcccaacagcaccggtttcgaggcgggctccgaggac
ctgggcatacggccaatcgttcgcaagcacgtaaagcgcaaaatgaaaagagtgccgaag
gcgaaagtaaccctcgaactggacgaaaaaaaccagcaagaggttgacgaaaagtcagta
aaaacggagccaatagatgaggaagttgaccggacagatgaagccccaactcaagaggct
caaactaccgcgatctccattaaatcagagactgaggctgagcacaaagcagccgtagat
gttcatataaagcaagaggatactatcaggttagatatagttaataatccagtagagagc
acttccatagttatcactgaagagccgaaagacctggaaaaaagtactgaagaactggca
tttgccctgccattggcctcctccacggaggtggatctgaaatctccacccgacttgagc
tccacggcgctcgccacatccatcaaatccccctcctctgtgagcatcgatagcgccaaa
ggcctgtccatagtcactgatcccggttggcccacctaccaagttggtgatttgttttgg
ggcaaggtcttctcgtactgcttctggccctgcatggtgtgtccggatccgcttggccag
attgtgggcaacatgccgagccatcctcagcgctcatcccttgacaacgccaacgttccc
attcaagtgcatgtgcgctttttcgccgacaatggacgacgcaactggattaaaccggag
aatctgctgacctttgccggactgaaggctttcgatgacatgcgcgaggaattgcgaatt
aagcatggaccaaagagcgccaagtaccgtcagatggtgcccaagcggacaaaggttgtc
atctggcgacaagccatcgaagaggcgcaagctatgacccagatcccgtactccgatcgt
ctcgaaaaattctaccagacgtacgaaaacgttgtcactcttaataggcaaaaacgcaag
cggaccaagtatatgatgcaggacacttctgacgtgggcagcagcctgtacgactccacg
gacaacctgcacaacaagcaaggcacgcagttgctggccgtgaaacgagaacgctcggag
tcgccctttagtccggctttctcgcccgtaaagagcaaaaacgaaaagcgggccaagcgc
cgcaaactgagcaatggcaccgaagcggatactggcagcaacagcatggcagtaactcct
tcacagaccgaaacaactgtggacagctccgcttatgaaaatcccgagttcagacagctc
ttgtctgccgtcatggaatatgtaatgatgaaccggtcagatgaaaaagtggagaaggtt
ctgctctccgtggtgagcaatatttggtccctaaagcaaatccagttgcgcgagctagag
cgcgacttggccagcggcgaaattgaggagcctttgggctcgtcggtggttggtcgtggc
agcggtgttggcactatcaagcggctttcgaatcgccttatgaccatgatggtgcgccgt
agcatgactccagtagtgacacccagtacaacgcccgcaccatcggagccagatcgtcgc
ctttccgagcccccaaagaccaagaagcccgtcaaccggcccatagaagaagtgattgaa
gacatcttgcagctggacagcaagtacctcttccgtgggcttagccgcgagcccatatgc
aaatattgttaccaggcgggatccgatctagtgcgctgctcgcgcacctgctcgagctgg
ctgcatgccgactgcctggaacgaaaggtgacaggagctccgatgcccaaaataggcagt
cgaaaggctctggtcattccacccacatcgaaatctcccagtcccgatgaggatcatgta
acagccgacgccaaggaggttgttgccgttggtacctcactggtgtgtcatgagtgcaat
gtgggcgaaccggaaggctgtgtcatttgccatcaagttgaatcgccagctgtaccaagc
actccccggaaggaggattcatcatcgcacacgccaatcgaagataagctcctgacatgc
agccagcctatgtgtggaaagcggtttcacacgagttgctgcaaatattggccgcaggcg
agcagcagcaaacattcggcgcgttgtccacggcacgtgtgccacacatgcgtctccgac
gatcccagcggcaagttccagcagctgggcagctccaaactggccaagtgcgttcgctgc
ccggccacgtatcaccagctctcaaaatgcattccagccggcacccagatgctcaacact
accaatataatctgtccgcgtcacaacatcgccaaggcggatgcccacgtcaatgttctg
tggtgctacatctgcgtcaaaggcggcgaattggtatgctgcgaaacgtgccccattgct
gtgcacgcccactgccggaatattcccatcaagaccaatgagagctacatctgtgaggag
tgcgagagcggtcgtctaccgctgtacggcgagatcgtgtgggcgaagttcaacaacttc
cgctggtggccggccattatcctgccacccactgaggtgcccagcaatatactaaagaag
gctcacggcgagaatgactttgtggtgcgattctttggcacacacgatcatggctggatt
tcacgacgtcgcgtttatctctacatcgagggggatacgggagatggacataagaccaaa
tcgcagctgtttcgcaactacaccaccggcgtggaagaggcgtcgcgcttccttccgatc
atcaaagcccgccggcaggaacaggacatggaacgccaaagcggtaataagctccatccg
cctccatatgtgaaaatcaagaccaataaggcggtgccaccgttgcgattctcgcagaat
ctagaggatttgagtacttgtaactgcctgccggtggacgagcatccctgtggcccggaa
gctggctgccttaaccgcatgctgttcaatgaatgcaatccggagtactgcaaggctggc
agtctttgcgagaatcgaatgtttgagcaacgcaagtcgccacgtttggaggtggtctac
atgaacgagcgaggatttggcctcgtcaaccgtgagcccatagccgtgggtgactttgtc
atcgagtacgtgggcgaggtgatcaaccatgccgagttccagcggcgcatggagcagaag
cagcgtgatcgcgacgagaactactacttcttgggtgtggaaaaggactttataatcgat
gcgggaccgaagggcaacttggctcgcttcatgaaccattcgtgcgagcccaactgcgag
actcagaagtggaccgtcaattgcatccatcgtgtgggcatatttgcaatcaaagacatt
ccagtgaactcggagctcaccttcaactacttgtgggacgacttaatgaacaacagcaag
aaggcctgcttctgcggagcaaagcggtgttccggcgagataggcggcaaactcaaggat
gatgcagttaaggcccatgccaagttgaagcagatgcggcgggcaaaagcatccgccgtt
cgtatccatgtgaagcctaagaagactcccaaggtgaaacacataagtgcggacgatgag
ccaatggatgcgaaggacgagtaa

DBGET integrated database retrieval system