KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5027Help
Entry
Dmel_CG5027       CDS       T00030                                 

Definition
CG5027 gene product from transcript CG5027-RA (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmel_CG5027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:72D10-72D10
AA seq 430 aa AA seqDB search
MSPNSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIA
YGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPDEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaaattctatgtggattttcggcctcataagtgctctgcttctgactctgggt
tcgacggggctatcctcgaaggttttggagctcagtgaccggttcatcgatgtgcgacac
gagggccaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cccatttttgctctggtggctcaggctttgcatgccaccaacgttcgagtgggtcgccta
gattgtaccaagtatccggcggcggcgaaggagttcaaggttcgtggctatcccaccatt
atgttcatcaagggcaacatggagttcacctacaacggagaccgcggtcgcgatgagctg
gtggattatgccttaaggatgtctgggcctccagttcagctggtcacgcgaacggagagt
gtggacatgctaaagggatcccatacgatatttttcattttcgtaggccaacaggagggc
gtggtgtgggatacatactatgctgcagctgaaggttaccaagagcatggatttttctat
gccaccagcgaggatatcgctgcccaacactttgactttgagaaactgccagcggtgatt
gtctacaaagaagagcagcaccacttctatccgcatgggcatttggcgcacgaaatggac
cccaatgaagtgaacgaaaccgttttccaatgggtgaacgtggagaggttcacactcttc
ccaaaggtcactcggttcaacatccaccagctgctcaagacaaacaagtacttggttttg
gctgtggtacaggaggataagctcaatcagatagccacgcatgagctggagtttcgggac
atggtggagggcgtgataagaaagcatagggcgcgatatcatgacaaattccaatttgga
tggattggcgagccatcaatagcacattccattatcttggatcaactgcccacgcctcac
ttgatagcgattaattcgagcacccaacaccacttcatacccgaagatgatccaatgcaa
atgactccacaggcactgcaccttttcctagaatccatccgcaacgaaagtgccattgcc
tatggaggagatacgtactttgtacgtttgaatcgggcactgttcgaagtgcgaagagca
ttaagggatatgtggctgggaaatcccgtgctgaccactgtcatcttcggcctgccattg
ggattcttatcgctcatcatgtactctattttctgcggcgattgcttggtcacagaagaa
gatcccgatgaagatcacgagaagaaggagtaa

DBGET integrated database retrieval system