KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5072Help
Entry
Dmel_CG5072       CDS       T00030                                 

Gene name
Cdk4
Definition
Cyclin-dependent kinase 4 (EC:2.7.11.- 2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dmel_CG5072 (Cdk4)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dmel_CG5072 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:53C9-53C9
AA seq 317 aa AA seqDB search
MSYVRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRIS
LNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDL
IDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQL
DRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLR
PSALACLEHDYFQQEPL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatgtacgccagctgaagcggcagaaaatgtcccaggcgaagaagttcggcgat
ggcgatccgttcaactaccaggagctcaacatcatcggcgaaggtgcctatggaacggtt
tacagagcccgcgatgtgatcaccggcaacatagtggcgctgaagaaggttaggatatcg
ctgaacgagaacggtgtgccaatgtccacgctgcgggagatttcgctgctgaagcagctg
aatgccagcaatcatgcgaatattgtcaaactgtacgaagtatgccagtttctggagcgc
gacggccaattgctgattctgttggttttcgaacatgtggagcaggatctttcggatctt
atagacagacttcccaaatcgggcatgtcgccgcccacaattcagcgcttgtcaagggaa
ctactgaccggtgtggacttcttacactcacaccgtatcatccatcgggatcttaagccg
caaaacctgctggtctcctcgcagggccacctcaagatcgccgactttggcttggccaag
acctacggttcggagatgaagctcacctccgtggtggtcaccttgtggtaccgcgcaccc
gaggttctgctcgcccagccctacaacagcaccgtggacatctggagtgccgcctgcatc
atcttcgagatgttcaatcggcgcgccctattcccgggcacctccgaaaagaatcagctg
gaccgcatcttcgaactgaccggtagacccaccgagcaacagtggccacagaccatttcc
gtggccctggaacactttccccagcggcatccaaagagaccaaaagacttttgcccacac
ctgtgcaagtacgccgatgatctgttgaataaaatgctttcctacgacctccacctgcga
ccatccgccttggcctgtttggagcacgattactttcagcaggaacccctatag

DBGET integrated database retrieval system