KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5092Help
Entry
Dmel_CG5092       CDS       T00030                                 

Gene name
Tor
Definition
Target of rapamycin (EC:2.7.1.-)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG5092 (Tor)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dmel_CG5092 (Tor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34A4-34A4
AA seq 2471 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLGSS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSTQTHLGEGEHHKGVAKFASQHNVLESAYAQEILQEHYTSIC
DNVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAY
ITIGYMAVAVQSAIEVHLSSIMTSVKVALPSKDLTSKRKVPVDPAVFACITLLAHAVKSE
IADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAILPY
TALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLE
AVQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETF
DGKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKY
SGMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDL
AEVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPV
LIDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVD
ESQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIK
CVPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTIN
TPLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGS
TLGYYLPLILPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDA
EPELRDQAMTTLRSLAKQLGKKYLVFVPMVQRTLNKHRIVDPEYEELLSKIKSCSTLADS
YGAGESELRPSRFKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLS
IGLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVT
DMPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQV
FESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKTDSS
DLEARLGHMRCLEALGDWSELSNVTKHEWENFGTEAKSRAGPLAAVAAWGLQDWEAMREY
VRCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVC
VQMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHT
WLKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQE
AYEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQGALE
CFEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGMTMGSGLDSDLMIIQ
RYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQV
IPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSM
RKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAML
ERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQL
TSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSN
GKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIG
WVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDD
LAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDF
GDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVL
EAFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDP
TLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENL
CQCYIGWCPFW
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtacagaacaaggcaacccaggatctgctcttctatgtgaagaccgagctacgcgaaatg
tcccaggaggagctggcccaatttttcgacgagttcgaccatcacattttcacgatggtg
aatgcgacagatatcaacgagaaaaaaggcggtgccctggccatgaagtgcctgattaac
tgcgagggcagtcttactgccaggaagggcatttcgccctatctcaaccgcctgcgcgat
cttctgctaatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaaattg
gccaacatgcccacctccaagggcgccgattccttcgactttgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccattcagccgtctttatcctccgt
gagctggctatcgccttgcccacatacttctaccagcacatcctgaccttcttcgaggtt
atctttaacgccatcttcgatcccaaacctgctatacgagagtcagctggcgaggctttg
agggcggctttgattgtcaccgctcagcgagagagcaccaagcagtccagtgaaccacag
tggtacagaatctgctatgacgaggcgaatggaagcttcaatgcagacttgggctctagc
aaggatcagaaaggcgtgacccgagacgatcgcattcacggtggcctcgtcgtcttcaac
gagctctttcgctgtgccaatgccacctgggagcggcgctacacgtctctgaagacgctg
ttccccaagacccaacacaataagttcctggaggccagcagttcgtcgagtatgggttcc
cagctgaatactctagtgccgcggctaaaggtgcccttcattgacaagctcggcagcacc
caaacgcatttgggtgagggagagcatcacaaaggagttgccaagttcgcgagccagcac
aacgtactggagtccgcatatgctcaggagatccttcaggagcactacacctccatttgc
gacaatgttttggagcagcgaacttcgaagtctccgtatgtacagcaggcactccttcaa
atacttcctcgattggctgcctttaaccgcgcggtgtttgtggaaaaatacctgcagaca
tgcgtgtcgcatttaatgcagatcctgcgaggcaaggagaaggatcgcacggtggcgtac
ataaccattggttacatggctgtagcggtgcagagtgcgatcgaagttcatttatccagt
ataatgactagcgtgaaggtcgccttgccgtcaaaggatttgaccagcaaacgaaaggta
ccagtggatcctgcggtctttgcctgcataacgcttcttgctcatgccgttaagtcggag
atcgccgacgatgttaaggatatccttgagcagatgttctacacgggtctctcgccagct
ctgactgtttgcctgagggaactctccgagaatgtgccgcagcttaagtcggccattaca
gaaggattgatcggaatcctatcccaggtgctgatgaacaaggcggcaattttaccatac
actgctttgccaacgatcgccatcgatggctcgctaatgcagaatggtgacggagcaacc
acagtgctggcactcaaaacgctgggtaccttcaactttgaggagcaaaacatgctggac
tttgtgcaacgatgtgctgactacttcatcgttcacgagcagcaggagattcgtctggag
gcagtgcaaacatgcacacgactccttaaactggcagtgcaatcctctgaaagtatggag
aactccaagaccctcagcgacaccgtttcccacgtgattgagcgcctgcttatggtagcc
attactgatatggactgtaatgtgcgaatacgaattctacgttcgctggacgagaccttt
gatgggaagcttgctcagccagagtctctaaattcgctatttattacgctgcacgatgaa
atctttgagatccgggagctggcaatggttaccattggaagattgtcgtccataaacccg
gcttatgtgatgcccaagctaagaaccaccatgatcgaattgatcacggatctaaagtac
tcgggaatgagtcgaaacaaggagcagagcgcaaagatgcttgaccatttggtgataagc
acgcccaggctaatatcctcttacatgaatccgatcctcaaagccttagtgcccaagttg
catgagccggaatcgaatccaggagttattttaaatgtgcttcgcacaattggtgattta
gcagaggttaatggaggctccgatgaaatggaattgtgggcagatgaccttctgtccatt
ttactcgaaatgctgggcgacgctggcagtccggataagcgaggagtggctctgtggacg
ttgggacagttaatcagtgcaacaggcagggtggttaccccatatcacaagtaccccgtg
ctcatagatattttgattaatttccttaaaacggaacaacgtcgatccattcgaagggaa
acgatacgagtgctgggcttgttgggagccatggatccttacaagcacaagatgaacaag
ggcttgattgatagccaaaaggataatgttttaatagcatactccgatggcaaagtcgat
gaaagtcaggacatctccaccgctgagttgctagttaacatgggtaacgcattggatgag
tattatcccgctgtggccatagctgcattgatgaggattctacgggatcccacgttaagt
acacgtcacaccagcgtggtgcaggcggttacttttatcttccagagcctgggcatcaaa
tgtgtgccgtacttggcccaagtgcttcccaatttgctggacaatgtacgcactgcagat
aataatctaagggagtttctcttccagcagctcgccattctggtggcttttgtcaagctg
catatcatcagctacatgggagatatttttaagctgatcaaagaattttggaccattaat
acgcctctgcaaaacactctaatcaatttgattgaacagatcgccgtggctttgggatgc
gagtttagggattatttggcggagctgatcccacaaattctgcgagtgttgcagcacgat
aactccaaggatagaatggtcacgagaaggttgctccaagctcttcaaaagtttggcagc
actttgggttactatctgccgctgattttgcctccgatcgtgaaactcttcgattctccg
tacgtaccacaacaggtgtcaatggtagccctggaaacgatcaacaatctagcctgtcag
ctggacttcaccgacttctcctcgcgcatcatacatccgttggttcgagtgctggacgct
gagccagagcttcgggaccaagctatgacaacccttcgctcactggcaaagcaactgggc
aagaagtacctcgtgttcgtgcctatggtccagcgcactctcaacaaacatcgcattgtg
gatcccgagtacgaggagctactgagtaagattaagtcctgcagcacactggcggattcc
tatggggccggggagtcagaactgcggccgtccaggttcaaaaacaacgagccatttgtg
accgacagaaatagcaataataaaaatctgcaggtcaccacaaacgaactacgaacggcg
tggcaggtgacgcggcgggtgtccaaggacgactgggtggagtggctaaagcggttgtcc
attggcctgctgaaggaatcgccttcgcacgcactgagagcctgtcgttcgttggcccaa
gagtacgatacgctgttgagagatctttttaacgccgcatttatctcctgttggacggaa
ctatcgccggatttgaaaaacgagctaacacagtcactgattcaagccctgcaagttacc
gacatgccggaaatcactcagacaatcctcaacttggccgagtttatggagcattgcgat
cgcgatccaataccaatagaaactaagctattgggtactcgagcgatggcttgcagagcg
tatgccaaggcattgcgctacaaggaggaggagttccttctgcgagaagattcccaagtt
tttgagtccttgattctaatcaacaacaagctgcagcaaagagaagcagcggaaggtctg
ctcacaaggtatcgtaatgcagccaacgaactaaatgttcaaggaagatggtatgaaaaa
cttcacaattgggatgaggcgctggaacactatgaaaggaatctaaagacggattcctcg
gacttggaggcgcgactcggtcacatgcgctgcttggaggccctcggagattggtcggag
ctgagcaacgtgaccaagcacgagtgggaaaacttcggtacagaggccaaatcaagagca
ggacccttggccgcagtggccgcctggggtctccaggattgggaggcgatgcgggagtac
gtaaggtgtataccagaggatacccaagatggaagctactatcgtgctgtcctcgccgtg
catcatgacgactttgagaccgcacagcgccttattgacgaaacaagggacctcctcgac
acggagctcacatcaatggcgggcgagtcctatgaaagagcctacggagccatggtatgt
gtacaaatgctggcggagctggaggaggtcatccaatacaagctcattcccgagaggcga
gagccgttaaagaccatgtggtggaagcgtcttcaaggaggccagcgactagtagaagac
tggcgaaggatcatccaggtgcactcgctggtggtaaaaccgcacgaggacatacatacc
tggctgaagtacgctagtctgtgcaggaagagcggctccctgcacttgtcccataaaact
ctggtgatgctgctaggcaccgatcccaagcttaatccgaaccagccactgccttgtaat
caaccacaggtgacctatgcgtacaccaagtacatggctgccaataatcagctgcaggaa
gcctacgagcagttgacgcacttcgtcagcacctatagtcaggagctaagctgtttacct
ccggaagcactaaagcaacaagatcagcgactcatggcccgctgctatctgcgcatggcc
acctggcagaacaagctgcaggacagcatcagaccggatgccattcaaggcgcactcgaa
tgctttgaaaaggccaccagctatgatcccaactggtacaaggcctggcacctgtgggcg
tacatgaactttaaggtggtgcaggcccaaaaatcggcgctggacaaacaacagcctccg
ggagccagcatgggaatgacaatgggctctggcctcgacagtgatctaatgatcatacag
cgatacgccgttccggcagttcagggattcttccgttcaatcagccttataaaagggaat
tcgctgcaggatacgctacgtttgttaactctttggtttgactatggcaaccatgcagag
gtgtacgaggcgctgctctctggaatgaagctgatcgagatcaacacctggcttcaggtt
atcccgcagcttattgcccgcatcgatacccaccgtcagttggtgggtcaattaatccac
caactcctaatggacataggaaagaatcacccgcaggctctggtctatcctctaacagtc
gcttccaagtcagcatcattggcgcgcaggaacgccgcctttaagatcctcgactcgatg
aggaaacactcgcccaccttggtagagcaggcggtcatgtgtagtgaggagctcatccgt
gtggcgattctgtggcacgaacagtggcacgaaggtttggaggaagcctcgcgtctttac
tttggagatcgcaacgtaaagggcatgtttgagatcttggagccactgcatgctatgctg
gagaggggaccacaaacactcaaggagacatccttctcgcaggcctatggacgcgagctg
acagaggcgtacgagtggtcgcaacggtacaagacatcggcggtggtgatggatctggat
cgagcgtgggacatttactatcacgtcttccaaaagatctcgcgccagctgccacaactt
acctcgctggagctgccgtatgtctcgcccaaactgatgacgtgcaaagatctcgaactg
gcagtgcccgggtcctacaatcctggccaggagctcatccggattagtatcattaaaacc
aaccttcaggtgattacttccaagcagcggccgcgaaaactgtgcatacgcggctccaat
ggcaaggactatatgtaccttctaaagggacacgaggaccttcgtcaggacgaacgcgtg
atgcagctattctccctggtgaacacattgctgttggatgaccccgacactttccgtcgt
aacttggccatccagcggtatgcggttatcccgctcagtaccaactcgggtcttattggt
tgggtgccacattgtgacacccttcatacgctaatccgggactaccgcgacaagaagaag
gtgccactgaatcaggagcatcgcaccatgctcaattttgcgccagactatgatcacctc
acgctgatgcagaaggtggaagtgttcgagcatgcgttgggtcagacgcaaggcgacgac
ttggccaagttgctgtggctcaagtctccgtcctctgaattgtggtttgaacggagaaac
aactatacccgctcactggcagtcatgtcaatggttggatatatcctaggtctgggcgat
cgtcatccatcgaaccttatgctggatcgtatgagcggcaagatactgcacatagacttt
ggcgactgcttcgaggtggccatgacccgcgaaaagtttcccgaaaagatacccttccgt
ctcacccggatgctaataaaggcaatggaggtcactggcatcgagggcacctacagacgc
acctgcgaaagcgtgatgctggtgcttcgccgcaacaaggattccctgatggcggtgctg
gaggcctttgtctatgatccgctgctcaactggagactgttggatgtggacaagaagggt
aacgatgcggtggctggggcgggtgctccaggtggacgtggcggttccggaatgcaggat
agcctcagtaactccgtagaggactccctgcccatggccaagtcgaagccctacgatccg
acgctacagcaaggcggcctgcacaacaacgtggccgacgagacgaacagcaaagccagc
caggtaatcaagcgggtcaagtgcaagctaacaggcaccgacttccagacggaaaagagc
gtaaacgagcagtcgcaggtggagctgctcatccagcaggcgaccaataacgagaacctc
tgccagtgctacattggctggtgtccgttttggtag

DBGET integrated database retrieval system