KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5092Help
Entry
Dmel_CG5092       CDS       T00030                                 

Gene name
Tor
Definition
(RefSeq) Target of rapamycin (EC:2.7.11.-)
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG5092 (Tor)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG5092 (Tor)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG5092 (Tor)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dmel_CG5092 (Tor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34A4-34A4
AA seq 2470 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLGSS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSTQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTSICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYMAVAVQSAIEVHLSSIMTSVKVALPSKDLTSKRKVPVDPAVFACITLLAHAVKSEI
ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAILPYT
ALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD
GKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYS
GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT
PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLILPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDAE
PELRDQAMTTLRSLAKQLGKKYLVFVPMVQRTLNKHRIVDPEYEELLSKIKSCSTLADSY
GAGESELRPSRFKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLSI
GLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQVF
ESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKTDSSD
LEARLGHMRCLEALGDWSELSNVTKHEWENFGTEAKSRAGPLAAVAAWGLQDWEAMREYV
RCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQEA
YEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQGALEC
FEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGMTMGSGLDSDLMIIQR
YAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQVI
PQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSMR
KHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLE
RGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQLT
SLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSNG
KDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGW
VPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDL
AKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFG
DCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLE
AFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPT
LQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLC
QCYIGWCPFW
NT seq 7413 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtacagaacaaggcaacccaggatctgctcttctatgtgaagaccgagctacgcgaaatg
tcccaggaggagctggcccaatttttcgacgagttcgaccatcacattttcacgatggtg
aatgcgacagatatcaacgagaaaaaaggcggtgccctggccatgaagtgcctgattaac
tgcgagggcagtcttactgccaggaagggcatttcgccctatctcaaccgcctgcgcgat
cttctgctaatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaaattg
gccaacatgcccacctccaagggcgccgattccttcgactttgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccattcagccgtctttatcctccgt
gagctggctatcgccttgcccacatacttctaccagcacatcctgaccttcttcgaggtt
atctttaacgccatcttcgatcccaaacctgctatacgagagtcagctggcgaggctttg
agggcggctttgattgtcaccgctcagcgagagagcaccaagcagtccagtgaaccacag
tggtacagaatctgctatgacgaggcgaatggaagcttcaatgcagacttgggctctagc
aaggatcagaaaggcgtgacccgagacgatcgcattcacggtggcctcgtcgtcttcaac
gagctctttcgctgtgccaatgccacctgggagcggcgctacacgtctctgaagacgctg
ttccccaagacccaacacaataagttcctggaggccagcagttcgtcgagtatgggttcc
cagctgaatactctagtgccgcggctaaaggtgcccttcattgacaagctcggcagcacc
caaacgcatttgggtgagggagagcatcacaaaggagttgccaagttcgcgagccacaac
gtactggagtccgcatatgctcaggagatccttcaggagcactacacctccatttgcgac
aatgttttggagcagcgaacttcgaagtctccgtatgtacagcaggcactccttcaaata
cttcctcgattggctgcctttaaccgcgcggtgtttgtggaaaaatacctgcagacatgc
gtgtcgcatttaatgcagatcctgcgaggcaaggagaaggatcgcacggtggcgtacata
accattggttacatggctgtagcggtgcagagtgcgatcgaagttcatttatccagtata
atgactagcgtgaaggtcgccttgccgtcaaaggatttgaccagcaaacgaaaggtacca
gtggatcctgcggtctttgcctgcataacgcttcttgctcatgccgttaagtcggagatc
gccgacgatgttaaggatatccttgagcagatgttctacacgggtctctcgccagctctg
actgtttgcctgagggaactctccgagaatgtgccgcagcttaagtcggccattacagaa
ggattgatcggaatcctatcccaggtgctgatgaacaaggcggcaattttaccatacact
gctttgccaacgatcgccatcgatggctcgctaatgcagaatggtgacggagcaaccaca
gtgctggcactcaaaacgctgggtaccttcaactttgaggagcaaaacatgctggacttt
gtgcaacgatgtgctgactacttcatcgttcacgagcagcaggagattcgtctggaggca
gtgcaaacatgcacacgactccttaaactggcagtgcaatcctctgaaagtatggagaac
tccaagaccctcagcgacaccgtttcccacgtgattgagcgcctgcttatggtagccatt
actgatatggactgtaatgtgcgaatacgaattctacgttcgctggacgagacctttgat
gggaagcttgctcagccagagtctctaaattcgctatttattacgctgcacgatgaaatc
tttgagatccgggagctggcaatggttaccattggaagattgtcgtccataaacccggct
tatgtgatgcccaagctaagaaccaccatgatcgaattgatcacggatctaaagtactcg
ggaatgagtcgaaacaaggagcagagcgcaaagatgcttgaccatttggtgataagcacg
cccaggctaatatcctcttacatgaatccgatcctcaaagccttagtgcccaagttgcat
gagccggaatcgaatccaggagttattttaaatgtgcttcgcacaattggtgatttagca
gaggttaatggaggctccgatgaaatggaattgtgggcagatgaccttctgtccatttta
ctcgaaatgctgggcgacgctggcagtccggataagcgaggagtggctctgtggacgttg
ggacagttaatcagtgcaacaggcagggtggttaccccatatcacaagtaccccgtgctc
atagatattttgattaatttccttaaaacggaacaacgtcgatccattcgaagggaaacg
atacgagtgctgggcttgttgggagccatggatccttacaagcacaagatgaacaagggc
ttgattgatagccaaaaggataatgttttaatagcatactccgatggcaaagtcgatgaa
agtcaggacatctccaccgctgagttgctagttaacatgggtaacgcattggatgagtat
tatcccgctgtggccatagctgcattgatgaggattctacgggatcccacgttaagtaca
cgtcacaccagcgtggtgcaggcggttacttttatcttccagagcctgggcatcaaatgt
gtgccgtacttggcccaagtgcttcccaatttgctggacaatgtacgcactgcagataat
aatctaagggagtttctcttccagcagctcgccattctggtggcttttgtcaagctgcat
atcatcagctacatgggagatatttttaagctgatcaaagaattttggaccattaatacg
cctctgcaaaacactctaatcaatttgattgaacagatcgccgtggctttgggatgcgag
tttagggattatttggcggagctgatcccacaaattctgcgagtgttgcagcacgataac
tccaaggatagaatggtcacgagaaggttgctccaagctcttcaaaagtttggcagcact
ttgggttactatctgccgctgattttgcctccgatcgtgaaactcttcgattctccgtac
gtaccacaacaggtgtcaatggtagccctggaaacgatcaacaatctagcctgtcagctg
gacttcaccgacttctcctcgcgcatcatacatccgttggttcgagtgctggacgctgag
ccagagcttcgggaccaagctatgacaacccttcgctcactggcaaagcaactgggcaag
aagtacctcgtgttcgtgcctatggtccagcgcactctcaacaaacatcgcattgtggat
cccgagtacgaggagctactgagtaagattaagtcctgcagcacactggcggattcctat
ggggccggggagtcagaactgcggccgtccaggttcaaaaacaacgagccatttgtgacc
gacagaaatagcaataataaaaatctgcaggtcaccacaaacgaactacgaacggcgtgg
caggtgacgcggcgggtgtccaaggacgactgggtggagtggctaaagcggttgtccatt
ggcctgctgaaggaatcgccttcgcacgcactgagagcctgtcgttcgttggcccaagag
tacgatacgctgttgagagatctttttaacgccgcatttatctcctgttggacggaacta
tcgccggatttgaaaaacgagctaacacagtcactgattcaagccctgcaagttaccgac
atgccggaaatcactcagacaatcctcaacttggccgagtttatggagcattgcgatcgc
gatccaataccaatagaaactaagctattgggtactcgagcgatggcttgcagagcgtat
gccaaggcattgcgctacaaggaggaggagttccttctgcgagaagattcccaagttttt
gagtccttgattctaatcaacaacaagctgcagcaaagagaagcagcggaaggtctgctc
acaaggtatcgtaatgcagccaacgaactaaatgttcaaggaagatggtatgaaaaactt
cacaattgggatgaggcgctggaacactatgaaaggaatctaaagacggattcctcggac
ttggaggcgcgactcggtcacatgcgctgcttggaggccctcggagattggtcggagctg
agcaacgtgaccaagcacgagtgggaaaacttcggtacagaggccaaatcaagagcagga
cccttggccgcagtggccgcctggggtctccaggattgggaggcgatgcgggagtacgta
aggtgtataccagaggatacccaagatggaagctactatcgtgctgtcctcgccgtgcat
catgacgactttgagaccgcacagcgccttattgacgaaacaagggacctcctcgacacg
gagctcacatcaatggcgggcgagtcctatgaaagagcctacggagccatggtatgtgta
caaatgctggcggagctggaggaggtcatccaatacaagctcattcccgagaggcgagag
ccgttaaagaccatgtggtggaagcgtcttcaaggaggccagcgactagtagaagactgg
cgaaggatcatccaggtgcactcgctggtggtaaaaccgcacgaggacatacatacctgg
ctgaagtacgctagtctgtgcaggaagagcggctccctgcacttgtcccataaaactctg
gtgatgctgctaggcaccgatcccaagcttaatccgaaccagccactgccttgtaatcaa
ccacaggtgacctatgcgtacaccaagtacatggctgccaataatcagctgcaggaagcc
tacgagcagttgacgcacttcgtcagcacctatagtcaggagctaagctgtttacctccg
gaagcactaaagcaacaagatcagcgactcatggcccgctgctatctgcgcatggccacc
tggcagaacaagctgcaggacagcatcagaccggatgccattcaaggcgcactcgaatgc
tttgaaaaggccaccagctatgatcccaactggtacaaggcctggcacctgtgggcgtac
atgaactttaaggtggtgcaggcccaaaaatcggcgctggacaaacaacagcctccggga
gccagcatgggaatgacaatgggctctggcctcgacagtgatctaatgatcatacagcga
tacgccgttccggcagttcagggattcttccgttcaatcagccttataaaagggaattcg
ctgcaggatacgctacgtttgttaactctttggtttgactatggcaaccatgcagaggtg
tacgaggcgctgctctctggaatgaagctgatcgagatcaacacctggcttcaggttatc
ccgcagcttattgcccgcatcgatacccaccgtcagttggtgggtcaattaatccaccaa
ctcctaatggacataggaaagaatcacccgcaggctctggtctatcctctaacagtcgct
tccaagtcagcatcattggcgcgcaggaacgccgcctttaagatcctcgactcgatgagg
aaacactcgcccaccttggtagagcaggcggtcatgtgtagtgaggagctcatccgtgtg
gcgattctgtggcacgaacagtggcacgaaggtttggaggaagcctcgcgtctttacttt
ggagatcgcaacgtaaagggcatgtttgagatcttggagccactgcatgctatgctggag
aggggaccacaaacactcaaggagacatccttctcgcaggcctatggacgcgagctgaca
gaggcgtacgagtggtcgcaacggtacaagacatcggcggtggtgatggatctggatcga
gcgtgggacatttactatcacgtcttccaaaagatctcgcgccagctgccacaacttacc
tcgctggagctgccgtatgtctcgcccaaactgatgacgtgcaaagatctcgaactggca
gtgcccgggtcctacaatcctggccaggagctcatccggattagtatcattaaaaccaac
cttcaggtgattacttccaagcagcggccgcgaaaactgtgcatacgcggctccaatggc
aaggactatatgtaccttctaaagggacacgaggaccttcgtcaggacgaacgcgtgatg
cagctattctccctggtgaacacattgctgttggatgaccccgacactttccgtcgtaac
ttggccatccagcggtatgcggttatcccgctcagtaccaactcgggtcttattggttgg
gtgccacattgtgacacccttcatacgctaatccgggactaccgcgacaagaagaaggtg
ccactgaatcaggagcatcgcaccatgctcaattttgcgccagactatgatcacctcacg
ctgatgcagaaggtggaagtgttcgagcatgcgttgggtcagacgcaaggcgacgacttg
gccaagttgctgtggctcaagtctccgtcctctgaattgtggtttgaacggagaaacaac
tatacccgctcactggcagtcatgtcaatggttggatatatcctaggtctgggcgatcgt
catccatcgaaccttatgctggatcgtatgagcggcaagatactgcacatagactttggc
gactgcttcgaggtggccatgacccgcgaaaagtttcccgaaaagatacccttccgtctc
acccggatgctaataaaggcaatggaggtcactggcatcgagggcacctacagacgcacc
tgcgaaagcgtgatgctggtgcttcgccgcaacaaggattccctgatggcggtgctggag
gcctttgtctatgatccgctgctcaactggagactgttggatgtggacaagaagggtaac
gatgcggtggctggggcgggtgctccaggtggacgtggcggttccggaatgcaggatagc
ctcagtaactccgtagaggactccctgcccatggccaagtcgaagccctacgatccgacg
ctacagcaaggcggcctgcacaacaacgtggccgacgagacgaacagcaaagccagccag
gtaatcaagcgggtcaagtgcaagctaacaggcaccgacttccagacggaaaagagcgta
aacgagcagtcgcaggtggagctgctcatccagcaggcgaccaataacgagaacctctgc
cagtgctacattggctggtgtccgttttggtag

DBGET integrated database retrieval system