KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5150Help
Entry
Dmel_CG5150       CDS       T00030                                 

Definition
CG5150 gene product from transcript CG5150-RA (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dme00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:64D5-64D5
AA seq 517 aa AA seqDB search
MLSLKFWIRLGLLTVVWGAAVPGRAPVDEERMHPHLPTSPRLRTISGEETQEFWHSASKK
LIREKLEFVRNTKKAKNIILFLGDGMGLATLAAARSYIGGEELKLSFEEFPFTGLSKTYS
VDKIVPDSACTSTSYLCGVKANYGTIGVNAHVKRGDCAAMANETNHVFSLGKWAMDAGKA
AGLVTTTRVTHASPSGVYAHVADREWENNAVLEEACGELSDGLQDIAVQLIHGEVGSKLK
VMLGGGKRSFYSPEHYDKGRRTDGRNLVEEFEALDAGNTFVKTQKKLLNVNATETGRLLG
LFSKSHMHYHLEQLADPDNNEPTLEEMTQKAIEVLETEEQGYFLFVEGGKIDISHHETMA
RIALDETAELSKAVKKAREMTNPEETLIVVTSDHSHTFSVSGYQPRGSDIFGAAKANGKD
GKPYLALSYANGKSFQDYYNTETHERVDPTSLPTIGDFDQLFPAMVPLESETHGGEDVGV
FASGPWAHLFTGVYEQNTIPHMMAFAACVGDGLTACD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtcttaagttctggattcgcctcggtctgctgaccgtcgtttggggtgcagcg
gttcctggaagagcccccgtggacgaggagcgaatgcatccacatctgcccactagtccc
aggctgcgtacgatttccggcgaggaaacccaggagttctggcactcggccagcaaaaaa
ctcatccgcgaaaagttggagttcgtgaggaacaccaagaaggccaagaacattatactg
tttttgggcgatggcatgggactggctactctggctgctgccaggagttacattggaggc
gaggagttgaagctctccttcgaagaattcccctttaccggactatcgaaaacctattcg
gtggacaaaatagtccccgatagcgcctgtacctcaacctcatatctctgcggagtgaag
gcgaactacggaaccatcggcgtaaatgcgcatgtgaagcgaggcgactgtgcggcgatg
gccaatgaaacgaaccatgtcttctccctgggtaaatgggccatggatgcgggcaaagct
gctggactagtgaccaccacccgagtgacccacgcctcgccatccggagtctacgcccat
gtcgccgatcgtgaatgggagaataacgctgttctcgaggaggcctgcggtgagttgtca
gatggactccaggacatagctgtccagttgattcacggcgaggtgggcagcaaactcaag
gtcatgctgggtggaggcaagcgaagcttctatagtccggaacactacgacaagggccgg
cgcactgatggtcgtaatctcgtcgaggaattcgaagccttggacgcgggcaacaccttt
gtgaaaacgcagaagaagctgctcaatgtgaacgccactgaaaccggtagattgttgggc
ctgttcagcaagagccacatgcactatcatctggagcaactggccgatccggacaacaat
gagcccaccttggaggagatgacacagaaggccattgaagtgctggaaaccgaagagcag
ggatacttccttttcgttgaaggaggtaaaatcgacatcagccaccacgaaacaatggca
cgaattgctttggatgagaccgctgaactctcgaaggcggtgaagaaggctagggagatg
accaacccggaggagaccctcattgtggtgacctcggatcactcgcacaccttcagcgtt
tcgggatatcaaccacgaggaagcgacatctttggagctgccaaggcgaatggcaaggat
ggcaaaccgtatctggccttgagctatgccaacggcaagagtttccaggactactacaat
acggagacccacgagcgcgtggatcccaccagtctgcccacaatcggagacttcgatcag
ctcttccccgcgatggtgccccttgaatcggagacccatggcggcgaggatgtgggtgtc
ttcgcctcgggaccctgggcacatctcttcactggcgtctacgaacagaacaccattcct
cacatgatggcattcgctgcctgtgtgggcgatggactaaccgcttgcgattag

DBGET integrated database retrieval system