KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5214Help
Entry
Dmel_CG5214       CDS       T00030                                 

Definition
CG5214 gene product from transcript CG5214-RA (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG5214
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmel_CG5214
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG5214
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dmel_CG5214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86D9-86D9
AA seq 468 aa AA seqDB search
MTGIISIVTRRLPQTLGMRALRSNEVKRCIRQYSRLVACAAQQQQLLRQDGSNRCQEATR
LLTWQGIHTTSSLWSEQTVNVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVA
VPAPFSGTLTDILVKDGDTVKPGQALFKIKPGAAPAKAAAPAAAPAPAAPKAAPAPAAAP
KPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKPAVAQVKVPPADGSRQILGTRSEQ
RVKMNRMRLKIAARLKDAQNTCAMLTTFNEVDMSYAMDFRKQNLDAFTKKYGIKFGFMSI
FAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIEI
ALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFERPIA
VKGEVKIRPMMYIALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttcgatcgtaacgagacggctgccccaaactttgggaatgcgagcc
ctgcggagtaatgaggtaaagcgctgcatccgccaatattctcggttagttgcctgcgcc
gcccagcagcagcaactgcttcgccaggatggctcgaatcgctgccaggaggccaccagg
cttctcacctggcagggaatccacaccacgtcgagcttgtggtcggagcagaccgtcaat
gtgccaccctttgcggactccattgccgagggtgacatcaagtttacttgcaaggtgggt
gactcattcgccgctgacgaggctgtcatggaaatcgagaccgacaagacgacggtggct
gtgccagctcccttctccggaactctaaccgacattctggtgaaggatggcgacaccgtc
aagcccggccaggctctgttcaagatcaagcccggtgcagcgcccgccaaggcagctgct
ccagcggctgctcctgcgcctgctgccccaaaagcagcaccagctccagctgctgcaccc
aagccggcacctccaccacctgcggccggcgcaccaaagccaccaccaccgccaccacca
aaggcagcccctcgaccaccgccacctgctccagtggctgcactcaaaccggccgtcgcc
caggtgaaggtgccaccagcggacggatcgcggcagatcctaggcactaggtccgagcag
cgtgtcaagatgaaccgcatgcgtctaaagattgccgcccgcttgaaggatgcccagaac
acatgtgccatgctcaccactttcaacgaggttgatatgagctatgccatggacttccga
aagcagaatctggatgcgttcactaagaagtatggtattaagtttggattcatgtcgatc
ttcgccaaggctagtgcctatgcgctgcaggatcagcccgtagtgaacgccgtcatcgat
ggcacggacatcgtgtatcgcgactacgttgacatctctgtggccgtggctacgccccgt
ggattggtggtacccgtcatccgcaacgtggagggcatgaactatgcggacatcgagatc
gcactggccggtctggccgataaggccaggcgtgatgccatcaccgtggaggacatggac
ggtggcaccttcaccatcagcaatggcggagtgttcggatccctgatgggcacgcccatc
atcaatccgccacagagtgccattctcggcatgcacggcatctttgagcggccaattgct
gtcaagggagaggtcaagatacgtcctatgatgtacatcgccctgacctacgatcaccga
atcattgatggacgtgaggcggtcctgttcctgcgaaaaataaaggctgccgtagagaac
ccagcaataattgttgccggattgtaa

DBGET integrated database retrieval system