KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5214Help
Entry
Dmel_CG5214       CDS       T00030                                 

Definition
(RefSeq) CG5214 gene product from transcript CG5214-RA (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG5214
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmel_CG5214
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG5214
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dmel_CG5214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86D9-86D9
AA seq 468 aa AA seqDB search
MTGIISIVTRRLPQTLGMRALRSNEVKRCIRQYSRLVACAAQQQQLLRQDGSNRCQEATR
LLTWQGIHTTSSLWSEQTVNVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVA
VPAPFSGTLTDILVKDGDTVKPGQALFKIKPGAAPAKAAAPAAAPAPAAPKAAPAPAAAP
KPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKPAVAQVKVPPADGSRQILGTRSEQ
RVKMNRMRLKIAARLKDAQNTCAMLTTFNEVDMSYAMDFRKQNLDAFTKKYGIKFGFMSI
FAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIEI
ALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFERPIA
VKGEVKIRPMMYIALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttcgatcgtaacgagacggctgccccaaactttgggaatgcgagcc
ctgcggagtaatgaggtaaagcgctgcatccgccaatattctcggttagttgcctgcgcc
gcccagcagcagcaactgcttcgccaggatggctcgaatcgctgccaggaggccaccagg
cttctcacctggcagggaatccacaccacgtcgagcttgtggtcggagcagaccgtcaat
gtgccaccctttgcggactccattgccgagggtgacatcaagtttacttgcaaggtgggt
gactcattcgccgctgacgaggctgtcatggaaatcgagaccgacaagacgacggtggct
gtgccagctcccttctccggaactctaaccgacattctggtgaaggatggcgacaccgtc
aagcccggccaggctctgttcaagatcaagcccggtgcagcgcccgccaaggcagctgct
ccagcggctgctcctgcgcctgctgccccaaaagcagcaccagctccagctgctgcaccc
aagccggcacctccaccacctgcggccggcgcaccaaagccaccaccaccgccaccacca
aaggcagcccctcgaccaccgccacctgctccagtggctgcactcaaaccggccgtcgcc
caggtgaaggtgccaccagcggacggatcgcggcagatcctaggcactaggtccgagcag
cgtgtcaagatgaaccgcatgcgtctaaagattgccgcccgcttgaaggatgcccagaac
acatgtgccatgctcaccactttcaacgaggttgatatgagctatgccatggacttccga
aagcagaatctggatgcgttcactaagaagtatggtattaagtttggattcatgtcgatc
ttcgccaaggctagtgcctatgcgctgcaggatcagcccgtagtgaacgccgtcatcgat
ggcacggacatcgtgtatcgcgactacgttgacatctctgtggccgtggctacgccccgt
ggattggtggtacccgtcatccgcaacgtggagggcatgaactatgcggacatcgagatc
gcactggccggtctggccgataaggccaggcgtgatgccatcaccgtggaggacatggac
ggtggcaccttcaccatcagcaatggcggagtgttcggatccctgatgggcacgcccatc
atcaatccgccacagagtgccattctcggcatgcacggcatctttgagcggccaattgct
gtcaagggagaggtcaagatacgtcctatgatgtacatcgccctgacctacgatcaccga
atcattgatggacgtgaggcggtcctgttcctgcgaaaaataaaggctgccgtagagaac
ccagcaataattgttgccggattgtaa

DBGET integrated database retrieval system