KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5229Help
Entry
Dmel_CG5229       CDS       T00030                                 

Gene name
chm
Definition
chameau (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG5229 (chm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:27F3-27F4
AA seq 703 aa AA seqDB search
MALESGSSSSESGSSSTSGSTSSETGSSSDTDSSSATPEEKPSTNSSAKSQTQTQQQTNS
GNAQRRKPVPAASEDKPKPSVAPSSKKVNNPPKSKLSSDDDEYEDSAPPAKKNSRAMGSS
TVTAAAAASAARRKPPASVNKPSNPANKPSNPTQRSANNNTNRSLENGEGKRPSLSSSSN
STDDSMKIVKNGRKVPLKMASTVRPKQIRGKLPPAKKNGGGPVISSDGSSGSESGSNSGD
ESSSGSESEGSDSSNSYSSQPVKGGAKGKRSGPTKIQNSDSEEERKDKANPMRKLTRSLS
MRRTKQQPKQETDSESDGDLEDDKIMISKSPAKKPAPSNLNASKSKVKREPIGISSGVLS
SIKSRPVSPITQTEKKCPIEGCDSSGHLSGNLDKHFLPEACPIYHNMSASECKERANERK
LRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQREFLAKIRESRANFKPANNNFLDSKVKLE
KDVTDEDREPNLAGLVPDYDLQLFREAQAQASERIEDELKDLPVGKGIKYISMGKYKMKV
WYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYRKGKLQVWQV
DGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPFLQE
KNSFYNVSCILTLPPYQRKGYGRLLIDFIYNHSAIKCIELVLL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggccttggagtccggcagcagcagctcggagtcgggcagctcatccacaagcggatcc
accagttcggaaacgggcagcagctcggacacggattccagcagtgcgacgccggaggag
aagccatccacgaattcctccgccaaatcccagacgcaaacacaacaacaaactaattcc
ggaaatgcacagagaagaaagcctgttcctgcggcgtcggaggataaacccaagccgagc
gtagcgccatctagcaaaaaagtaaacaatcctcccaaaagtaaactctccagcgatgac
gacgaatatgaggactcggcgccgccggccaaaaagaactcacgtgcaatgggcagttcc
actgtaacagcggcagctgccgcctcagcagccaggagaaaaccacccgcgtccgtcaac
aagccaagcaatcccgctaacaaaccgagcaatcctacccagcgatcggccaacaacaac
acaaatcgatcactggagaacggcgagggcaagcgaccctcgctctcctcctcgtccaat
agcacagatgactctatgaagatcgttaaaaacgggcggaaggttcccctcaaaatggcc
agcacggtgaggcccaaacaaatccgaggaaaattgccgccggcaaagaaaaacggcggg
ggaccggtgatcagcagtgacggaagttcgggctccgagagtggctccaactcgggcgac
gaatcaagttcaggaagcgagtctgagggaagtgattccagcaactcctacagctcgcag
ccagtaaaaggaggagctaaaggtaagagaagcggaccaacaaaaatccaaaactccgac
agcgaagaagagcgaaaagacaaggccaatcccatgaggaaactgacgcgatcactcagc
atgcgaaggacaaaacagcaacccaaacaggaaaccgattctgaatccgatggagaccta
gaagatgacaaaattatgatctccaaaagtcccgccaaaaagccagcgccctcgaatttg
aacgccagcaaaagcaaagtgaaaagggaaccaatcggaatcagcagtggcgtgctgagc
tccattaaatcccgacccgtgtcaccgattacccagactgagaagaagtgtcccatcgag
ggctgcgattcatccggacatctgagtggcaatttggataagcactttttgccggaggcc
tgtcctatctatcacaacatgtccgcctcggagtgcaaagagcgtgccaatgagagaaaa
ctgaggaatgaacagcgactaaagatgccggttaacattgtgacggcgccgggtaaccaa
aacaccaatctcaagacgctctcgcctgagcagcgcgagtttctggccaagattcgcgag
tcaagggctaactttaagccggcgaataacaattttttagactcgaaggtaaagctggaa
aaagacgtaacggacgaggaccgggaaccaaatctggcaggcctggtgcctgactatgat
ttgcaattgttccgggaagcgcaagctcaagcatccgaaaggatcgaagacgaactcaag
gacctgcccgtgggaaagggaataaaatatatcagcatgggcaagtacaagatgaaggtc
tggtatcaatccccttatccggacgatgctgcccgcctgcccaaaatgtatatctgcgaa
ttctgcctgcgctaccaaaaatcagagacgggcatcaagcggcatgccgagaaatgcgtc
tggcggcatccgccgggcgatgagatataccgcaagggcaaactacaggtgtggcaggtg
gacgggaaacgttataagcaatactgtcagcatctgtgcctgctagcaaaattctttctg
gatcacaaaaccctctactacgatgtggagcccttccttttctacattatgacgctggcc
gatgtggatggatgtcatattgttggttattttagcaagcatattcctttcctgcaggag
aagaactcgttttacaatgtttcctgtattttaacattgccgccatatcagcgaaagggt
tacggaagattactcatcgatttcatttacaaccattctgcaatcaaatgcatcgaactc
gtcttactatga

DBGET integrated database retrieval system