KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5261Help
Entry
Dmel_CG5261       CDS       T00030                                 

Gene name
muc
Definition
(RefSeq) midline uncoordinated, isoform C
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00010  Glycolysis / Gluconeogenesis
dme00020  Citrate cycle (TCA cycle)
dme00620  Pyruvate metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Module
dme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG5261 (muc)
   00020 Citrate cycle (TCA cycle)
    Dmel_CG5261 (muc)
   00620 Pyruvate metabolism
    Dmel_CG5261 (muc)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dmel_CG5261 (muc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl CCDC53 DUF3614 Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 34021
NCBI-ProteinID: NP_001260193
FlyBase: FBgn0283658
UniProt: M9PCA2
Position
2L
AA seq 473 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRKLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAAAAAPPPPPPPAAAPAAAAPPPAPAAAPAAAGQKAAAKPAAAAPAKAPRAA
GARYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVDKLLKFRAKVNKKYEKQGARVS
VNDFIIKAVAIASLKVPEANSAWMDTVIRKYDDVDVSVAVSTDKGLITPIVFNADRKGVL
EISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFGVNQFAAVINPPQSCILAIGTTTK
QLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARWLQHFRDYMEDPSNMVL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggttgtgcgcgccctc
agcagccagctgatcaactcccggaaactccagagcatcaggtcgaaacttaacactagc
cagtcaccggtcacatggagctacaacttcgcccgtgcctatgccaaccttccggaacac
atcagggtgccactgcccgcactttccccgactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgataagctcaacgaaggtgacttgctgtgcgagattgagacggat
aaggccaccatgggctttgagacgcccgaggagggctttctggctaagattctcatccag
ggcggcaccaaggacgttcccgttggccagctgctgtgcattatcgtgccggaccaaggc
agcgtagctgctttcgcgaacttcaaggacgacggtgccgccgcagcaccagctgctccg
gcagcagctccagctccagcaccggcagcagcagcagctccgccaccaccaccaccaccc
gccgcagctccagcagccgctgcgcctccaccagctcccgccgctgctccagctgcagca
ggccagaaagcagcagccaagccagctgctgcggcacctgccaaggcccccagggcagct
ggagcgcgctacgaggacattccggtgaccaacatgcgcgcagtgattgccaaacgtctg
ctggagtccaagacacaactgcctcactactacgtcaccgtgcaatgccaagtggataag
ctgctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcccgcgtctct
gtaaacgacttcattatcaaggccgtggccattgccagtcttaaggttcccgaagcgaac
tccgcctggatggacacagtaattcgcaagtacgacgacgtcgatgtttcggttgctgtc
tccacagacaagggtctgattaccccgattgttttcaatgccgaccgcaagggtgtcctg
gagatctctaaggatgtcaaggcgctggcagccaaggcgcgcgacaacaaacttcagccc
cacgaattccagggtggcaccatctcggtttctaatctgggcatgttcggtgtgaaccag
tttgccgctgtcatcaaccctcctcaatcgtgcatccttgccattggcaccacaacgaaa
cagttggttgctgatcccgacagtctcaagggcttcaaggaggtcaacatgctgacggtc
accctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcagcac
ttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system