KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5261Help
Entry
Dmel_CG5261       CDS       T00030                                 

Definition
CG5261 gene product from transcript CG5261-RB (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG5261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG5261
   00020 Citrate cycle (TCA cycle)
    Dmel_CG5261
   00620 Pyruvate metabolism
    Dmel_CG5261
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dmel_CG5261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:27F4-27F4
AA seq 473 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRKLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAAAAAPPPPPPPAAAPAAAAPPPAPAAAPAAAGQKAAAKPAAAAPAKAPRAA
GARYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVDKLLKFRAKVNKKYEKQGARVS
VNDFIIKAVAIASLKVPEANSAWMDTVIRKYDDVDVSVAVSTDKGLITPIVFNADRKGVL
EISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFGVNQFAAVINPPQSCILAIGTTTK
QLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARWLQHFRDYMEDPSNMVL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggttgtgcgcgccctc
agcagccagctgatcaactcccggaaactccagagcatcaggtcgaaacttaacactagc
cagtcaccggtcacatggagctacaacttcgcccgtgcctatgccaaccttccggaacac
atcagggtgccactgcccgcactttccccgactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgataagctcaacgaaggtgacttgctgtgcgagattgagacggat
aaggccaccatgggctttgagacgcccgaggagggctttctggctaagattctcatccag
ggcggcaccaaggacgttcccgttggccagctgctgtgcattatcgtgccggaccaaggc
agcgtagctgctttcgcgaacttcaaggacgacggtgccgccgcagcaccagctgctccg
gcagcagctccagctccagcaccggcagcagcagcagctccgccaccaccaccaccaccc
gccgcagctccagcagccgctgcgcctccaccagctcccgccgctgctccagctgcagca
ggccagaaagcagcagccaagccagctgctgcggcacctgccaaggcccccagggcagct
ggagcgcgctacgaggacattccggtgaccaacatgcgcgcagtgattgccaaacgtctg
ctggagtccaagacacaactgcctcactactacgtcaccgtgcaatgccaagtggataag
ctgctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcccgcgtctct
gtaaacgacttcattatcaaggccgtggccattgccagtcttaaggttcccgaagcgaac
tccgcctggatggacacagtaattcgcaagtacgacgacgtcgatgtttcggttgctgtc
tccacagacaagggtctgattaccccgattgttttcaatgccgaccgcaagggtgtcctg
gagatctctaaggatgtcaaggcgctggcagccaaggcgcgcgacaacaaacttcagccc
cacgaattccagggtggcaccatctcggtttctaatctgggcatgttcggtgtgaaccag
tttgccgctgtcatcaaccctcctcaatcgtgcatccttgccattggcaccacaacgaaa
cagttggttgctgatcccgacagtctcaagggcttcaaggaggtcaacatgctgacggtc
accctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcagcac
ttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system