KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5384Help
Entry
Dmel_CG5384       CDS       T00030                                 

Definition
CG5384 gene product from transcript CG5384-RB (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG5384
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG5384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:31D4-31D5
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgttgta
aacaccgacgaggagccgattttgtttaaggctcagttgtttgccctcactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctgaaggatgaccagtggaatctg
cagatcaaggacggcgctgtggtcctgttgctgggcagcaaggaaagtgttccagaagtg
cctgccactcctgtcaaattcattgaggacatgaatgaagctgaggcagccacagcgatg
cgtctaccggctgggctgacaaatctgggcaatacgtgctacatgaatgccactgtccag
tgcctgaatgcagtgcccgagcttcgcactgccctgagcactttcagtaatgatggaacc
gacactatgtcgaccgcattttccatatcgtctgccatgaagtctatatttgctcaaatg
gagaagggcaccaccgtgacgccaattgtgctgctgcaggcattgcaccgggcatcaccg
caatttgcccagactggcgaaaatggcacatacaggcagcaggacgccaatgagtgctgg
gcggagatcctgaaaatgttgcagcaaaagctgcggccaaaaaaccaggaaccctcgaat
actgtccagaaaaggcacagctcgtttatcgaccagttttttggtggcacttttgaagtt
aagatgagctcagaagaggatcccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttccatggatgtgaagtacatgcagagtggtctgaaatctaaa
atgaaagagcagctggtgaaaaaatcagaaaccctgggacgcgatgcaaagtacattcga
acttacttggtgagccgacttccagcctatctcaccgtacaattcgtgcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatatcaaattccccattgacttc
gatgcctttgagttgtgtacccccgaattgcaaaacaagctctgcccaatgcgttcgaaa
ttcaaggatctggaagacaagaaaatggaagttgacgttgtcaaacgcaatgaacccaac
gaagagaagaaggacgttaagtacgagcagttctggttcgacgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggacgctccagttcgtcg
ggtcattatgtggcctgggttcgctccagcggcgatgtgtggttcaagttcgatgatgat
gaggtctccgccgtggccacggacgagattttgcggctttccggtggcggagactggcat
tgcgcctatgtcctgttatatgcgcccagacgtttggagaaactataa

DBGET integrated database retrieval system