KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5475Help
Entry
Dmel_CG5475       CDS       T00030                                 

Gene name
Mpk2
Definition
CG5475 gene product from transcript CG5475-RB (EC:2.7.11.- 2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG5475 (Mpk2)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG5475 (Mpk2)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dmel_CG5475 (Mpk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:95E5-95E5
AA seq 366 aa AA seqDB search
MSVSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKR
ITAEEALSHPYLEKYAEPSVEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSYAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtccattacaaaaaagttttacaagttggatataaatcgaacggaatgggag
atcccggatatataccaggatctgcagcccgtgggatcgggagcttacggacaggtgtca
aaggcagttgttcgtggcaccaatatgcatgtggccattaaaaagcttgccaggcctttt
caatcagctgtccatgcaaagaggacgtaccgggagcttcgacttttaaagcatatggat
catgagaacgtaatcggtctgctggacatattccatccacatcccgctaatggatcgctg
gagaacttccaacaggtgtacttggttacccacttgatggacgcagatctgaacaacatc
atacggatgcagcacttgtccgacgaccacgtccagtttttagtctaccagatactccgt
ggcttgaagtatatccacagcgccggagtgatccaccgtgatcttaagccctcaaacatt
gccgtcaacgaggattgcgagctgcgcattctagacttcgggctggcccgcccaacggag
aacgagatgacaggctatgtggccacgcgttggtaccgggcacctgaaataatgctcaat
tggatgcactacgaccaaacagtggacatctggtcggtgggctgcatcatggccgaacta
attaccagacgaaccctcttcccaggcaccgaccatattcaccagctaaacctgattatg
gagatgttgggcacgccacccgccgaatttttgaagaagatctcatcggaaagtgcacgt
tcctacatccagtcacttccgcctatgaagggacgaagttttaaaaatgtttttaagaac
gccaatccgctggccattgatttgctggaaaagatgttggagctagatgccgaaaagcgg
atcacagccgaggaggctctttcccatccatatctggagaagtatgcggagcccagcgtc
gagcagacctcaccaccatacgatcacagcttcgaggatatggatttgcccgtagacaaa
tggaaggaattgatctacaaggaggtcaccaactttaagcccccaccatcgtatgctcag
gttctaaaggatgtaaagtga

DBGET integrated database retrieval system