KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5475Help
Entry
Dmel_CG5475       CDS       T00030                                 

Gene name
p38a
Definition
(RefSeq) p38a MAP kinase, isoform C
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04624  Toll and Imd signaling pathway
dme04933  AGE-RAGE signaling pathway in diabetic complications
Module
dme_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG5475 (p38a)
   04068 FoxO signaling pathway
    Dmel_CG5475 (p38a)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG5475 (p38a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG5475 (p38a)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG5475 (p38a)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dmel_CG5475 (p38a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo RIO1 APH Kinase-like ABC1
Motif
Other DBs
NCBI-GeneID: 42866
NCBI-ProteinID: NP_001163711
FlyBase: FBgn0015765
UniProt: O62618 E1JIV6
Position
3R
AA seq 366 aa AA seqDB search
MSVSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKR
ITAEEALSHPYLEKYAEPSVEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSYAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtccattacaaaaaagttttacaagttggatataaatcgaacggaatgggag
atcccggatatataccaggatctgcagcccgtgggatcgggagcttacggacaggtgtca
aaggcagttgttcgtggcaccaatatgcatgtggccattaaaaagcttgccaggcctttt
caatcagctgtccatgcaaagaggacgtaccgggagcttcgacttttaaagcatatggat
catgagaacgtaatcggtctgctggacatattccatccacatcccgctaatggatcgctg
gagaacttccaacaggtgtacttggttacccacttgatggacgcagatctgaacaacatc
atacggatgcagcacttgtccgacgaccacgtccagtttttagtctaccagatactccgt
ggcttgaagtatatccacagcgccggagtgatccaccgtgatcttaagccctcaaacatt
gccgtcaacgaggattgcgagctgcgcattctagacttcgggctggcccgcccaacggag
aacgagatgacaggctatgtggccacgcgttggtaccgggcacctgaaataatgctcaat
tggatgcactacgaccaaacagtggacatctggtcggtgggctgcatcatggccgaacta
attaccagacgaaccctcttcccaggcaccgaccatattcaccagctaaacctgattatg
gagatgttgggcacgccacccgccgaatttttgaagaagatctcatcggaaagtgcacgt
tcctacatccagtcacttccgcctatgaagggacgaagttttaaaaatgtttttaagaac
gccaatccgctggccattgatttgctggaaaagatgttggagctagatgccgaaaagcgg
atcacagccgaggaggctctttcccatccatatctggagaagtatgcggagcccagcgtc
gagcagacctcaccaccatacgatcacagcttcgaggatatggatttgcccgtagacaaa
tggaaggaattgatctacaaggaggtcaccaactttaagcccccaccatcgtatgctcag
gttctaaaggatgtaaagtga

DBGET integrated database retrieval system