KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5505Help
Entry
Dmel_CG5505       CDS       T00030                                 

Gene name
scny
Definition
scrawny (EC:3.1.2.15)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:64E8-64E12
AA seq 976 aa AA seqDB search
MPVSMAVCETANVVNAALRESLGGNSSAGSSTDQAKSGEDTNGSLQNHIVANAKRILMAK
IEYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGKNNTGKLVGANGHDNNGARKQAE
HPNNQSHHINHHNHQHPTSNPNELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNT
CYLNSTLQALLHIPALANWLVSEQAHLADCNVAEPGSGCIICAMTKTLLATQSNQSAVRP
FLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQI
FGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAFEGHFSRERLEDMGYKCEGC
KKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISFKSRIDLSKYAARSQAAQAQPL
TYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYNFDDSYVRPIAMHSVCNTNAYIMFFELD
LSQAASPAANRPNGVRLTNGHSTTPVPAATVSSPSPTRFIGPQLPAGGANGYTNGNAQKT
AIQFKQQNQQSPQNGLQLGTGKFQDTAKPPLVGAHAKGEATSAPTANGNKSSSPSSNSSS
NHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTENHTEPKAKSPVKIQVKTPV
KTPLKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQESGQTNGHSKTNGSHTNGSASS
SVHVNNSKQKTDAIDEIFKSLKKSADSDEDDDEEEPSIQLTNGWHPQKQSQSQSKAPPSP
KTPPSPAVIKSKTGIWKVTRNDEVDAIEDDVDVVVVEGSPVKIPTPNKNHRNPFSSSKPS
TDSPATPGAKRQKLLNGSALKSHQQPRVGNGYQSNATSNGSTINELLKQSYRGYGSPVLS
WNGKPAELEKETFELVCAKRIAGHGSVEGSDIVEGSVAVDAAVTSGSDSKDVVVIAVAVT
DTTADAPDPDRLTDGR
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtttcgatggccgtatgcgaaacggcgaatgtcgtcaacgcagcgctgcgcgaa
tcccttggcggcaactcctccgccggctcgtcgactgaccaggccaagagcggcgaggac
accaacggcagcctgcaaaatcacatcgtggccaatgccaaacgcatcctgatggccaaa
atcgaatacgaggaggtgcccaactaccacgaatcggtgctggagaacctcaagtccaaa
tatattgtcatcaagccgggaaatccaggcgccatcaatggctttagtggcaaaaacaat
acaggcaaacttgtgggcgcaaatggacatgacaataacggcgcccgcaagcaagcggag
cacccgaacaatcagtcgcaccacatcaaccaccacaatcatcagcatccgacaagcaat
cccaatgagctgcccaagccgaagagggtcctctatccgcgggagaacatacgcattggc
tggaagcagtcggagcgcaaatggcaggtgggcacgggcatgatcaatgtgggcaacacc
tgctacctcaactcaacgcttcaggcgctcctgcacatacccgccctggccaattggctc
gtttcggagcaggcgcatctggctgactgcaatgtggccgaacctggcagcggttgcatc
atttgcgccatgaccaaaacacttttggccacccaaagcaatcagtcggccgtcagaccc
ttcctcatctactcgaagctaaagcagatctgcaaacacatggtcgttggtcgccaagag
gatgcgcacgagttcctgcgcttcctggtcgaggccatggagcgggcgtatttgatgcgg
tttcgtaactacaaagagctggatcagttggttaaggagaccacgccgctgggacagatc
tttggcggctatctgcgcagcgaggtgcgctgtctgagctgcaaccatgtgtccattacg
tttcagcacttccaggatctgttgctcgacatccgcaaggcagactccttggaggatgct
ttcgagggacacttttctcgcgaacggctagaggatatgggctacaagtgcgagggatgc
aagaagaaggtatctgccacaaagcaattctctttggagcgtgccccaatcacgctttgt
atacagctgaagcgattctccatgatcggcaacaaactgaccaagcagatttccttcaag
tcacgcatagatttgagcaaatacgcagcccgttcacaagcagctcaggctcaaccgctc
acctatcgcctggtgtcgatggtcactcacttgggggcgtcccagcactgcggtcactac
acggccattggctccacggatacgggcagcttttacaacttcgacgacagctacgtgcgg
ccaatcgcaatgcacagtgtgtgcaacacaaatgcctatataatgtttttcgaactggac
ctctcacaggctgccagtccggcggccaacaggcccaatggagtgcgtttgaccaacgga
cacagcacaacgccagtgccggcggcgactgtgtcttcgccttcaccaacgcgtttcatt
ggtcctcaactgccggcgggtggagcaaacggttacactaatggaaatgcccagaaaacc
gccatccagttcaagcaacaaaaccagcaaagtccacagaacggactccagctgggtacc
ggaaagtttcaggacactgcgaagcctccactggttggcgctcacgctaaaggcgaagct
acttcagctcccactgcaaatggtaacaaaagttcctccccaagcagcaacagcagcagc
aaccataaatcaataaaccagcaacaatatctgccaatttcctcggatgatgaagacatc
gaggatgagatgaagcccagaccaacgacagcccagctaccgagcatgcccaatatgacg
gagaatcatacggagcctaaggcaaagtctcctgtaaagattcaagtaaagactcccgtc
aaaacgccactgaaaagtcttgtgccctacgaatcagcatctgaggaggaggaggcgcct
ctaccgaatccccgcaagcgtccaagtggggaggattctagcgagtcggaccaagagtct
ggccagaccaatggtcacagtaagaccaatggcagccacaccaacggctcagcctcgtca
tcggttcacgttaacaacagcaaacaaaagactgatgccatagacgagatattcaagagc
ctaaaaaagtccgcagacagtgatgaggacgacgatgaggaggagcccagcattcagcta
acgaatggctggcacccacagaagcaatcacagtctcaaagcaaagcaccaccatcgcca
aagacgccaccctcgccagcggtcatcaaatcgaaaacgggtatctggaaagttacgcgt
aacgatgaggtcgatgccatcgaagatgatgttgacgtcgtggtggtggagggatcgccg
gtgaaaattccgacgccgaacaagaaccatcgcaatcccttctcgagtagcaagccctcc
acggactcgcccgcaacgccaggcgccaagcgccaaaagttgctcaacggcagtgcgctc
aagtcgcaccagcagccaagggtgggcaatggctaccagagcaatgccacctcgaatggg
agcaccatcaatgagctgctgaagcaatcgtatcgtggatacggctcccccgtgctcagt
tggaatggcaagcccgcggagctcgaaaaggagacttttgagttggtttgtgcgaaacgg
atagctggtcacggcagtgtggaaggcagcgatatcgtcgagggctcggttgcagtcgac
gcggcagtgactagtggcagtgacagtaaagatgtggtcgtaattgcagtggcggtaaca
gacacgaccgctgacgcacccgatccggatcgtctcacggacggccggtag

DBGET integrated database retrieval system