KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5548Help
Entry
Dmel_CG5548       CDS       T00030                                 

Definition
CG5548 gene product from transcript CG5548-RA (EC:1.6.5.3 1.6.99.3)
Orthology
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG5548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:13A8-13A8
AA seq 117 aa AA seqDB search
MGNALTHYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHL
AIAYQACRSDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKRLNKAA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcgctgacgcactacatgaaaccggacgtgatgcccggcccggacgtggtg
cccacctttgacccactgctgggcttcaagtcgcgcaaggagcgtgtgatgatcgccacc
caggaggagatggagtccgccaagctgccgctggaattccgcgactactgcgcccacctg
gctatcgcctaccaggcctgccgcagcgacaccttcccgtttgtgtacaagtgcgcccac
cagaagcacgagtacctcacctgcgagtacgaggactacgtgctccgcatgaaggagttc
gagcgggagcgccggctgctggagcgccagaagcgcctcaacaaggccgcctag

DBGET integrated database retrieval system