KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5656Help
Entry
Dmel_CG5656       CDS       T00030                                 

Definition
CG5656 gene product from transcript CG5656-RA (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmel_CG5656
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dmel_CG5656
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG5656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:78D2-78D2
AA seq 530 aa AA seqDB search
MRALRFFAALALQLTACSSQYKYGPEQSWDLDSISELKSKEFWFHDAQRTLYNKLSTPPN
QYRAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNRLEFEKFNYVGLSKTYCVNKQV
ADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVT
TTRVTHASPAGVYAHTSNRDFESDYDVTKLGQNPGNCPDIAQQLIDGDVGKRLRVVMGGG
TIKFLPNTTNDVFGNKGQRLDNRNLIEEWQQTKPGNARVVFSRTDLLNNDAQNTDFLLGL
FNASHLAYHMDDSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALD
ETVQFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSNVDQLPY
TSISYANGPAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAH
VVEYLLQGPWSHLFTGVYEQSTLPHLMGFASCLGPGITYCDLQPKARYSP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctctccggttctttgcggctcttgccctccaactcacggcctgtagcagccag
tacaaatatgggccagagcaatcctgggacctcgactctatttccgagttgaagagcaag
gagttctggtttcacgacgcccagcgcacgctctacaataagctatccactccaccaaac
caatatcgtgccaagaatgtcatatttttcctgggcgacggtatgtccgttcccacggta
accgcaggcaggatcttcgatggacagctgcgtggagtggtgggcgaacggaatcgtctg
gagttcgagaaattcaactatgtcggtctgtccaagacttattgcgtcaataagcaagtg
gctgactccgcctgcacagcatcggcctatctgtcggggatcaaggcgaactatctgacc
atcggagtgacagccgatgtggagttgaacgactgcaggggatcgcgcttgccgcagaat
aggctctcctcgattgccgcctgggcgcttaaaggtagcaaatccgctggattggtgacc
accactcgggttacccacgccagtccggccggagtttatgcgcacacttcgaatcgcgat
ttcgagagcgactacgacgtgaccaaattgggtcaaaatccaggaaactgtccggatatc
gcccagcaattgatagacggagatgtgggcaagcgactgcgtgtggtcatgggcggtgga
accattaaattcttgcccaataccacgaacgatgtgttcggaaacaagggccagcggttg
gataataggaacctcattgaggaatggcaacaaacaaagccgggtaatgctagggtggtg
tttagtcgtacggatctcctgaacaatgatgcgcagaacactgacttcctgctggggctc
ttcaatgcctctcacttggcgtaccacatggacgacagcatagacacacccacgctaccc
gagatgacggcagcggccataaatgtgctttcccgagatccaaacgggtatttccttttc
gtggaaggcggtcgaatcgatcacgcccatcatgagaccaaggccaagaaggccttggat
gaaaccgttcagttttcggacgcagtgagaaaggcacgacaactcaccaatccctgggac
accttaattgtggtgagtgcggatcacggacacacggtcacgatcagcggctatccggat
gttaacaacagcatagtaggactcaattccgagctaagtaatgtggaccagctgccctac
acgtccatctcatatgccaacggcccggcctacgagagattctacaaatcgacggacgga
gtggtggagcgcgttgatctccgtaacctggacttttccaaaccggatgccatctatcca
catggagtgcccatgaccgaggagacacacggcggtggcgatgtggccgtctatgctcat
gttgtggaatatcttcttcaaggtccatggtctcatcttttcactggagtttacgaacaa
agcaccttgcctcatttgatgggcttcgcctcttgcttaggacctggaattacatattgc
gatctgcagccaaaagcaagatactctccctag

DBGET integrated database retrieval system