KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5665Help
Entry
Dmel_CG5665       CDS       T00030                                 

Definition
(RefSeq) CG5665, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 395 aa AA seqDB search
MRILCGIVILLRLGALGDIAVDEEGRLTRSWWDAVPRLLTDIATIKANILTAAPLELASN
IIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
ILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLI
PRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQ
PGCLTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSPMGYRMNPQ
ARGIYYVDVNGWPPYGRNSENTVDPRLKTCYLCRR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaggattctgtgtggcattgttatcctattacgcctcggagcattgggagatatagct
gttgacgaagagggaaggttgacgcgaagctggtgggatgcagtgcctagacttttaact
gacatcgccaccattaaggcgaacatactcacagctgctccacttgaattggcttccaac
ataattgatgctgtgtgttcttccaccctctttatggacagaatccctgcgcaaatcact
ccggacataaggaagatgcattttcagtacatgacgccgtgccagaactacagtgtgccc
ctgctggaggcctcgaagctgtggaagcactctcgattcagcaagggacgtaaggtggta
attctggccaccggatggaccaacaccgtaaacgaatcctcggccatttcgatgatctct
aaggcattcatgtgtcgtggcgatgtgaattttgtgattgtagatgcggctgactatgtg
gacaccttctacgcgtggtcggcgctgaacacggatttaattggagagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgaaatattcacttgattggtgggttc
ataaaggaatcctttgtgtccataaattctggttctgatttctttgtaggacattcacta
ggagctcacattatgggcactgctggtcggacttttaagaagcttaccggaaaacttata
cccaggataactggcttggatccggccaagccatgtttcaggcgggaaaagattctgcca
ggattgacgcgtggcgatgccaagctagtggacataatccacaccaacattggtattttg
gccaagcgtggacccctcggtgatgtggacttctatcccggcggagcacatcccatccag
ccaggctgcctaaccatcggatgctctcatacccgagccgttgagtatttcgccgagagt
gcatatccacaccaagagaagaactttatgggcaagaagtgcgcttcttgggatgagcta
agaaaacgggattgttctgctggcatagtttccccgatgggctatcgaatgaatccccaa
gccaggggcatctactacgtagatgtcaatggctggcccccttacggccgaaactcggag
aacactgttgatcctaggcttaaaacgtgctacttgtgccggaggtga

DBGET integrated database retrieval system