KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5680Help
Entry
Dmel_CG5680       CDS       T00030                                 

Gene name
bsk
Definition
basket (EC:2.7.11.- 2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG5680 (bsk)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG5680 (bsk)
   04391 Hippo signaling pathway -fly
    Dmel_CG5680 (bsk)
   04068 FoxO signaling pathway
    Dmel_CG5680 (bsk)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG5680 (bsk)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmel_CG5680 (bsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:31B1-31B1; 2L:2-33 cM
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccaacactacaccgtcgaggtgggggacaccaacttcaccatc
cacagtcggtacattaatctacggcccataggatcaggtgcccaaggaatagtatgcgcc
gcttacgatactatcacccagcaaaatgtggcgattaagaaactatctcgaccattccaa
aatgtaacccatgccaagcgagcatatagggaattcaagctaatgaagcttgttaaccat
aaaaacataattggcttacttaatgcttttacgccgcaaaggaacttggaagagtttcag
gatgtctacctggtcatggagctgatggacgctaatctctgccaggtcatccaaatggac
ttggatcacgacagaatgtcctatttgctttatcaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggccgac
tgcactctaaaaattttggatttcggtctggcacgtactgcaggaactacctttatgatg
actccctatgtggtcacccgatattacagggctccagaggtcattttgggcatgggatac
acagagaacgtggacatatggtccgtcggttgcattatgggcgaaatgatacggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatcaccctcgtttatgcaacggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttccaaat
gataataatcagaatagccgccggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcatgaatatatc
aacgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatatgatcacagc
gtggacgaaagggaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaatacaaataatagaacgcggtag

DBGET integrated database retrieval system