KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5680Help
Entry
Dmel_CG5680       CDS       T00030                                 

Gene name
bsk
Definition
basket (EC:2.7.11.- 2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dme04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dme04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:dme04391]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dme04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:31B1-31B1; 2L:2-33 cM
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccaacactacaccgtcgaggtgggggacaccaacttcaccatc
cacagtcggtacattaatctacggcccataggatcaggtgcccaaggaatagtatgcgcc
gcttacgatactatcacccagcaaaatgtggcgattaagaaactatctcgaccattccaa
aatgtaacccatgccaagcgagcatatagggaattcaagctaatgaagcttgttaaccat
aaaaacataattggcttacttaatgcttttacgccgcaaaggaacttggaagagtttcag
gatgtctacctggtcatggagctgatggacgctaatctctgccaggtcatccaaatggac
ttggatcacgacagaatgtcctatttgctttatcaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggccgac
tgcactctaaaaattttggatttcggtctggcacgtactgcaggaactacctttatgatg
actccctatgtggtcacccgatattacagggctccagaggtcattttgggcatgggatac
acagagaacgtggacatatggtccgtcggttgcattatgggcgaaatgatacggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatcaccctcgtttatgcaacggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttccaaat
gataataatcagaatagccgccggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcatgaatatatc
aacgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatatgatcacagc
gtggacgaaagggaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaatacaaataatagaacgcggtag

DBGET integrated database retrieval system