KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5686Help
Entry
Dmel_CG5686       CDS       T00030                                 

Gene name
chico
Definition
CG5686 gene product from transcript CG5686-RB
Orthology
K16172  
insulin receptor substrate 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG5686 (chico)
   04150 mTOR signaling pathway
    Dmel_CG5686 (chico)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:31B1-31B1
AA seq 968 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSTSAARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDHVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAIATNMHNTILSAMSAKTESNTNLI
NVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLELRSCSSPHNYGFGRERCDS
LPTRNGTLSESSNQTYFGSNHGLRSNTISGIRPHSTNKHSNSPTFTMPLRCSESEESSIS
VDESDDNGSFSHYRLNTRSSETAIPEENIDDFASAELFSKVTEQNVSDENYIPMNPVNPT
DAIHEKEKADMQRLEDASLHFNFPEHASEKLAKDFDLDSDNQCCRPIRAYSIGNKVEHLK
FNKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFTANRSQSSITKEG
TSYGSSANRQKKSTSAPLLSLKNQINSDRMSDLMEIDFSQATNLEKQKFIKNNEIPKYIE
NVFPKAPRTDSSSLTLHATSQKDIFNGTKLNNTAITSEDGYLEMKPVGNGYTPSSNCLPM
KVEKLKLSDYQTAPPLTATAAPVHDLNKISTYNISAEKWREQPSRSEEKKSNSPLNDNTF
SSKPTNVESTSKSHDVHSANQIDCEKVCAQSSDKLNNHLADKIVENNNLDIGGHEEKKLV
HSISSEDYTQIKDKSNDFTKFNEAGYKILQIKSDSSLISSKLYQKGIHKDNLERSQRLTE
SVNTIPDNATATAVSSSSLTKFNINSAKPAAAADSRSTGTDPSTPQNILQIKDLNFPSRS
SSRISQPELHYASLDLPHCSGQNPAKYLKRGSRESPPVSACPEDGNTYAKIDFDQSDSSS
SSSNIFNT
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgctgagtggctacctcaagaagctgaagacc
atgaagaagaagttctttgtgctgtacgaggagacgagcacttcggcagcccggctggag
tactacgataccgaaaagaagttcctgcaaagagccgagccaaaaagggttatatatctg
aagaattgcttcaacatcaatcgccgtttggacaccaagcatagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctcgagaacgaaaatgatttacgcaaatgg
ttggacaaactactagttctacaaaggaacatagccaattcgaatggaacagcgcactca
ccttatgaccacgtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcattgga
ccggagaagacgcccaatggcgaggatcgcgttgcgagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatccccacaatgtatattctacgtggaacttggccgccaa
agtgtcttgggatctggtgatctgtggatggagacggataacgcagctattgctactaat
atgcacaacacgatactgagcgctatgtcagccaaaacagagtcgaacacgaatttaata
aacgtttatcagaatagacctgacttaagtcacgagcccatgagaaagcgatcgtcgtct
gcaaacgaagcatcgaagccgataaacgtaaatgtcatacaaaatagtcaaaactctctc
gaattgcgcagctgcagttcgccccataactatggtttcggcagagagagatgcgatagc
ttaccaaccagaaatggaaccctaagcgagtccagcaatcaaacgtactttggttccaac
catggactgcgatccaatactatatctggcatccgtccgcactcaaccaacaagcatagt
aatagtccaacgttcaccatgccattaagatgctcagaatccgaagagtcatcaattagt
gtcgatgaatccgacgacaacggcagttttagccactacagattaaacacgcggtcatcg
gagacggcaattcctgaggaaaacattgatgactttgccagtgcggaattatttagcaaa
gtcaccgaacaaaatgtaagtgacgaaaactacataccgatgaatccagtcaatcctacc
gatgctatccatgaaaaggagaaggctgatatgcagagattggaagatgcttcgctgcat
ttcaactttccggagcacgcgtcggaaaagcttgctaaggattttgatctggactctgat
aaccaatgctgtcgtcccattcgcgcctattcgataggcaacaaggttgagcatttaaag
tttaataagcgcctgggacacttgaatgatacgggacagaatccgaatcgcgtgcgagcc
tactcggttggctccaaatcgaagataccgcgctgcgacctgcagcgagtggtcctcgtg
gaggacaataaacatgagttcacagcgaataggagtcagagtagcattaccaaggaagga
accagctatggcagcagtgccaatcgacaaaagaagtccacaagtgctccactcctcagt
ctgaagaaccagataaactccgaccgaatgagtgacttaatggaaattgatttttcacaa
gcaaccaatttggaaaagcagaagttcatcaagaataatgaaattccgaaatacattgaa
aacgtgttcccaaaagccccgcgaacggatagctccagcctaactctgcacgccacaagt
caaaaggacattttcaatggcaccaaactaaataacactgcgatcacatccgaggatggt
tacctcgagatgaagccagtcggtaatggatacactcccagttcgaattgcctgccaatg
aaagtggagaaactcaagctatccgactatcagacagcaccgccactcaccgcaacagcc
gcaccagtgcacgatttaaacaaaattagcacatacaatatatccgctgagaaatggaga
gaacagcccagcagaagcgaggaaaagaagtcgaactcgccattgaatgacaacaccttt
agctcgaaacccacaaatgtcgagagtacaagcaaaagccatgatgttcattcagcaaat
caaattgattgcgagaaagtgtgcgcgcagagcagcgataagctaaataatcatctggcc
gacaagattgtcgagaacaacaatttggatataggcgggcatgaggaaaagaagttggtt
cattcgataagcagcgaagactacacacaaatcaaggacaaatcgaatgatttcacaaaa
tttaacgaagccggctacaaaattctgcaaattaaaagcgacagctcactcatctcatcg
aagctataccaaaagggtatacacaaggataacttggagcgttcgcagagacttacagag
agtgtgaatacgattcccgataatgccaccgccaccgcggtgagcagcagctcactcacc
aaattcaatataaattcagcaaagccagccgccgccgccgattcgcgtagcactggcaca
gatccaagtacaccacagaacattctacagattaaagatttgaatttcccctcaaggtcg
tcgtctcgcatatcccagccggagctgcactacgccagcctagatcttccccattgcagt
ggccaaaatccagctaaatacctgaagagaggatcacgcgaatcgccgccggtgtccgca
tgcccggaggatgggaatacctatgcgaaaatcgactttgaccaatccgactcctcttcc
tcctcatcgaacatatttaatacgtaa

DBGET integrated database retrieval system