KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5724Help
Entry
Dmel_CG5724       CDS       T00030                                 

Definition
CG5724 gene product from transcript CG5724-RA (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dme00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:dme00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dme00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dme00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dme00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dme00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dme00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:dme00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87C8-87C8
AA seq 530 aa AA seqDB search
MVHKSGIYLLLATAICVLGGCHGANILGVFTSLSPSHLIIQMSTAKVLAERGHNVTVITV
LKPVVNHKNITVIMVPLTKEESQQMSDTIGAMSKTDNSNMILSMLRMMGQMEFMFDKMAG
ALKDDRVRDLYLNRDNKFDLVLSGYFMNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGN
PLEIAYVPSISDSVEKGKGMSFRQRLAGYSSSFFFGIFDFVTQRRSKRLYKELFGDDPNM
PEYSELVKNTSLIFFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFLGNATD
GAILLSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWEDLEKTPGKSDNIFYSKWLPQ
DDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSLLS
LEEQPFKEAILEILSNPQYFDKVASFSSLYRDRPMSARESVIYWTEYVIRHHGAAHLQSP
LVHMSFIAANNIDIYALIAVVLVILVLLLKLLLQFIYRKIFAKPKKEKKH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggttcacaagtcaggaatatatctgctcctggccaccgccatctgtgttctaggtggc
tgtcatggtgccaatattttgggtgtcttcaccagcctaagtccctcgcatttaatcatc
caaatgagcacggccaaagttctggccgagagaggacacaatgtgacggtgatcacggtg
ctaaagccagtggtcaaccacaagaacattacagtgatcatggtgccactgaccaaggag
gagtcccagcaaatgagtgataccattggcgcgatgtcaaagactgacaacagcaacatg
atcctatccatgctccgcatgatgggtcagatggaatttatgttcgataagatggcgggt
gccctcaaggacgatcgtgttcgtgacctgtatctcaacagggacaacaagttcgacctg
gttctctctggatactttatgaacgtttaccagcttggattcgccaagaaagtgaaggca
cctgtcatcgtcgttgccacaatgccacccaatcaactgttgaatccattgatcgggaac
cccctggagatcgcctatgtgccctcaataagcgattccgtcgagaaaggtaaaggaatg
tccttccgacagcgcttggctggttacagctcaagcttcttcttcggaattttcgatttt
gtaacgcagaggcgtagtaagagattgtacaaggaattgttcggtgatgatcccaacatg
cctgagtactccgaactggtaaaaaacacgtcgttgattttcttcgcctcccacgcaccc
agtgagggtcccatccgaccaaatgttcctgctgccattgagatcggaggcatccaagta
aaggacacgccggatcccttgcctcagaatatggccgaatttctgggtaatgccacggat
ggcgctattcttttgtccttgggttccaatgtgaaaggaagccacataaatccggacacg
gttgtgaagatgttcaatgtattgtcgaagctcaagcaaagggtgatctggaagtgggag
gatctggagaagactcctggaaagtcagataacatcttctattcgaagtggcttccgcag
gacgatatcctagcccacccgaacataaagctatttattaatcacgccggaaagggtggc
ataaccgaagctcaatatcacggaaagcctatgctatccttgcctgtatttggggatcag
ccaggaaatgctgacgtcatggtcaaacaaggatttggccttacccagagtctgctctct
ctagaggagcagccgttcaaagaggctatcctagagatcttgtcgaatccgcagtatttt
gacaaggtggcttcgttctcctctctgtacagggatcgcccgatgagcgctagggaatcg
gtgatctactggacggagtacgtcatccggcaccatggagctgcccatcttcagagtcct
ctggtgcacatgagcttcatagccgccaataatatcgatatatatgctctaattgcagtc
gttctagtaattctagtactgcttctcaaattgctgctgcaatttatctataggaaaatt
ttcgcaaaaccaaagaaggagaagaagcactaa

DBGET integrated database retrieval system