KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5794Help
Entry
Dmel_CG5794       CDS       T00030                                 

Gene name
puf
Definition
puffyeye
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG5794 (puf)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG5794 (puf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:96A13-96A13
AA seq 3921 aa AA seqDB search
MCEVCADFQNLLELYEVRVASSDLKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDTKNYD
RFNLVVQSLICLTVQHLKHIDHLIDNYKRLTASAAQVVAQAQQQREQQRDEASAQAEAKE
SSAPAEEPKKEEPSGSAGEEAQGSGDGPAKKPPVGPCTPPPPQTANPQHKSHLQYTEEPW
ILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALICDLHDNDLPIYL
LRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTAAVSNVKLWLNYHCNTQLFVPLRSRI
LQYMCKLSDQSLRSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKYFTSTTLTMRLA
GMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENHIVQHLFGPNLHVEIVKQAHVL
LNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPSLVKNLTPRPAMHLYSLLCRMDPK
EHTEQSIYIASALTKQLWTRDTSRSQMNLMQDHLLGSNVTASSSDSGSIEGSNTEDDHVG
ADDSSIASGGGGGGVGNKSPIDGVTPCKQARHRRHICDPTTEKGKQISPEDMAKVDLVNK
RIVNIIDNTSSEEELQSRAALELQLHRSRKKTSNKRRRQKTNKQIILPHELVEIWDGVED
VPSSDEADGEADGDGEGELLADSDECSDGATSQLVPDAVLKHLQGEGPFIRAIETNINEL
LSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEELAQLVSSRANCSDVPPAFAAAAAA
MMVAQSAMALQKSGESNVAAAAAAVAAAAAATGTAQQTLVAMNRQASVAAAAAVVAAAKA
KSDSDVDLMDVVSGGKQHHSPKASQGSSTSGSTPVQPSFKLNDVCQPGNTLLWDLLQDDK
IGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLYNVANNRSVIVSLRLLPKLFASF
QQFRPSDTHSMTMWAERNHRMMQCFFNNIRHYARRHAEVLITQNGEQQQQQLGGQLYSHK
TQVSVRLQFLSSIFSTVGSPKSFRLTLEQLDALWEWLAHDPECADCYFSWLQAQAKGGDQ
HALGIEALQHLYLKKLPELRPEEFSMVALGLFQQLCSFARIAMAEYDNHSDQISASASAV
GMYHLWKIALRAQSNDVSLAAIQYINMYYMGQQLRLEKEFVSQCMENLVQAATALESIDD
ENALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSHSNLKNEGAGPPLRIVLQQ
AGLSEKSLLQMHACDLIADLKAEVSKWWESLQTGLAAPVLGLLLSDGPLRIITQGQELTS
DYDERSLGDAGFKDNQIVYVSLGGRGARRKESNLEHPSMLPPPPKECLPTVLLLQPKYFE
KLFCLMQTLGDMQPQASTVNPQHHTKAQLLSRRVWDILAMLPTNPHILDAFKSLVTDLSE
LEQLDAGGEEEQLATKRKQIKQKFRDLLDPNNLQKFMYSLHIVESLALTSSRRGESNGNV
AMGNTPEQVRVKKSSMGRRRNSNEQPPPPPPEVKMSKEQLCELEAPLTPTPSTGLQDVET
EASSSSGGDKENQPKQHSKRQKKGETFEQEKERPVGCSTPPSPTPPPPALSVVERGDNKW
SEAFVKCGGLRHLYEIFSEGQLQQSAHPKELALNEWRHDCLASLLRILWLLGFEELQSAD
AHVLMSRPHPFMLQLMEVPQCLTRLSSILNDEVHQQHQASSANPLVFPYQFQHLRTGFWG
RAQLIQFAMNILVSFVHASAEARRLLWAPTGTDHCRWLQKFILEDPEPAVRREICAGLYR
ICLGNAHSYRLLLAPLLHKLIALLPLAEQMSSGNQHTQFLLSEEGKDPYGPACRDYFWLL
ARLVDTLSPEMVAEEHIDIEMLCESISQSILTREYYELRHGYQDDGLVGLLNLMSNLIKY
DTTFKYTPKALSFIEQLIGFLFDMPSPADRQKPKCKSASSRASAYDLLVELCRGCATNYA
YLHGRLLAQHKSGPKQPYPWDYWPRDEGRAECGYVGLTNLGATCYMASCVQHLYMMPQAR
AAVLRVPPNAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDM
AEFFIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMR
NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML
KEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQKEKEGADGSGDGNDNEKAEATLD
DDIEECYEYELVGVTVHTGTADGGHYYSFIKERTKTSYHTHERWFLFNDAEVKPFDPSQI
AAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYERRLPEHLQRRHSELLVTPTPSP
TVEEKSEAEEPTKMETSSSEIKADVDVEVEVEEKDKEKPAQTDTESKETPAKEEIADDKS
KQDEPEEKKIEKQSREGEEKSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKASN
DQQPSTSKAAQKLQLFRPLLNKELEDWIWQDNRQFLQDRNIFEHTYFNFMWQICGHIPQS
LISETDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASQEACEWFLSHMSQE
PYWPVQVLIQCPNQMVRQMFQRLVIHVIQQLRASHAHLYLEVETDEDDKELIGQASCVTR
FIGSLISLLEHGARANLRHLSEYFGLLCEFSRMGDEEAMYLLRIGVLKSLVDFYLGHKQT
DSIDISSDNEDNSSEEALSVEKMRPASLDKMIALCASLVERSRGADFRLRLSPKDFSAIA
GGKGFPFLYQQIKDGINPHQTKHLIHALCRWDERLATQIIGMLFASVTKHTELCAPFFKL
LTLLTETQGGPVGLPCFTQLILPRMWDAAEYCPQSVLDWLSLQATKNKIAHAWILQSAEK
WLEQFLLAHDNTRVRNAAAFLLVALVPSQPFRANFRAHSQHKLLALNPHSYRDINSDAQA
VLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLMASSYMRSLWEL
FHPRLSEPSVPAHHNKHALLTFWHHSLVDCPENAAQVANCPEITRNIAFNYILADHDDAE
IVTYNRSMLPAYYGLLRLCCEQSRALTRQLSQHQNLQWAFKNITPHPTQYAAAVDELFKL
MALFATRHPDASEQEKLDVTQFRRAVIVSYTSSLDARVSWSTLISALKILVDNEEDRTMV
IFNGGIEMCFEALHTLHSMHHEATACHVAGDLFDLLGEMLLLLATLRTRTDSPAQKKQQQ
QQQQLEQQLQLQQQQMLQKQQQQSQSQTQTPQSPQQKEKQLQQQMQQHLQLQQLQQMQFQ
QQHFLRQQHQHSALAKALPDAVKRLATLLNTFNSPEISRMALEVLKELVRNPSLETISIL
APILINCHLSVANAPNAIGPLGPYFPRRGAKHTPWPLGAKNSPRPPRPMVQMCIALAELT
PRGLDADYDVQVESFYRPYHDFIDVMMRMCVNTGTLNDTLVKLQCLVAIESTPLHFTYFP
KFWVGIHNNALTHKYVELLVKNQLLVEYLHNVLRDERSMLKDACVREFLELYYHKVAAQL
PVARMIYTINYGMHSKDDIDELCGDLFAIRIIAQATGVPASVRKELRGSLRALQNKSERF
RKESERELSSSPYLPDPFPNKKQKRDSQKIKEKEHPQPESEKETSTENDKPSDVSMESSG
NAEQATDSTKPPTPAGSDDEQMDKTSVPSSDDETELEDELQPTPKRNKKASNKKTAQDRV
NEEREKRLITLITMESYIQSIFAILKRDASVPSSGATKEPSEEPCGEASTSAAAAVKLSR
PKGACTPPEPITDVNDTRCNIDTETEAEADEQSPKTSQTNGSQQNESPPAATSADTAPAN
PSPAPAAAVASTSQAASPTQI
NT seq 11766 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaggtgtgcgccgacttccagaatctcctggagctctatgaggtgcgcgtggcc
agctcggatctgaagttccagctgctgctgaagagcgagatcgagaccaccttcaactac
atccagtcgtggccgcagcgtcagtgcatgtgcctgtaccgggacaccaagaactatgac
cgtttcaacctggtagtgcagtcgctcatctgtctgacggtgcagcatctgaagcacatc
gaccacctcatcgacaactacaagcggctaacggccagtgctgcccaggtggtggcccag
gcccagcagcagcgtgaacagcagcgggacgaagcgtcagcccaggcagaggcaaaggaa
tcatccgcgccagcggaagaacctaagaaggaggagccatctgggtccgccggtgaggag
gctcagggctccggcgacgggccagccaaaaagccgccagttggcccctgcactccccct
cccccgcaaacggccaatcctcagcacaaatcccacctgcagtacacagaggagccctgg
atcctgcccgaggtggagaaactgttggtgctcgtttcaaaggtgttcctgctcaacttc
ccgctgtacatcgcccacaaacatggcatgcactctcggctggacgacctgcaggctgag
gaggcccaccacctggccctcatctgcgatcttcacgacaacgacctgcccatctatctg
ctgcggaatgtgagcctgttctgcaactcgggcggctttggcgccatgtcgctgtgcttc
gaacatcccgatctgccagtgtccaccgctcactcgatgaccgctgccgtctcaaatgtg
aaactttggctgaactatcactgtaatactcagctcttcgtgccgctgcgaagtcggata
ctgcagtacatgtgcaagctgtcggatcagagcctccgatctgccgcaacccgcgcgatg
gccgattttgtgtggtcctctatgcgagacccactggatgttgctgtcaacttcgacacc
gaaggattggccctggcctttaagtacttcacatcgaccacgctaaccatgcgactggca
ggcatggcccagatcaacgcacacattaatctatttaacgagatctgcaccaccgaaacg
gtcaacgaagtggagctgttcgggcagcgcatcgcgaactggctgactgaaaatcatatt
gtacagcacctgtttggcccgaatctgcacgtagaaatcgttaaacaggcacacgtgctg
ctcaactttttggcggtagagaaccagatctctgaagaggacatcaagctgatctggcaa
gccacccagctgaagcactgctcaaagacgatcttcgacatcctgccttcgctggtgaag
aatctgaccccgcgcccggcaatgcacctttactccctcctttgccgcatggatcccaag
gagcacactgagcagagcatatacatagcctcagcgctaacaaaacagctgtggactcgt
gatacctcacgcagtcagatgaacctgatgcaagaccacctgctggggtccaacgtcacc
gcttccagctctgacagcggcagcattgagggcagcaacacagaggacgaccacgtgggc
gccgacgacagtagcattgccagcggtggcggcggcggaggtgttggtaacaagagtcca
atcgatggagttactccatgcaagcaggcccggcacaggcggcacatctgtgaccccacc
accgagaagggaaagcaaataagtcccgaggatatggccaaagtagacttggtgaacaaa
cggattgtgaacattatcgacaacacaagcagtgaagaggagctgcaatcgcgggccgca
ctggagctgcaactgcatcgcagccgcaaaaagacgagcaacaagcgacggcgacaaaaa
accaacaaacagatcattctgccccatgagctggtcgagatttgggacggagttgaagat
gtgcccagcagtgacgaggctgatggcgaagccgatggtgatggcgagggcgaactttta
gcggacagcgatgagtgcagcgatggtgctacgagtcagctggtacccgacgccgtgcta
aagcatctgcagggagagggaccttttatcagggccatcgagaccaatatcaatgagctg
ctcagtggtgccgagaacgatggcagttactcatccccgatgagtaacaaatctgaaaag
aacctggctgacttcgatgacgaggacgtgtcgccttgcgaggaggagctggcccagctg
gtcagctcccgcgccaattgttcggacgttccaccagcctttgcagccgctgccgccgcc
atgatggtggcccagtcggcgatggcccttcagaagtctggagagtcgaatgtggctgct
gctgccgctgctgtggccgctgctgcagcggctaccggaactgcacagcaaacgctggtg
gcaatgaaccggcaggccagcgttgctgcagctgccgccgtggttgctgcggccaaggca
aaatcggactcagatgtcgatctgatggatgtggtttccggcggaaagcagcaccattca
ccaaaggcgagccagggcagctctacgtccgggagtacaccggtgcagccctcgttcaag
ctaaatgatgtctgccagcccggaaacacactgctttgggatctgcttcaagacgataaa
attggccaactaggcgagtctctggctctagaggcggagaaagctctggccactctcctg
tgcttcagcatggaccgccaactgcgaacgaaattcatcgagggttgtctgtataacgtc
gccaacaaccggagtgttattgtcagtctgcgactgctgcccaaactgttcgcctcgttc
caacagtttcgaccctcggacacgcactctatgacgatgtgggcagagcgaaatcaccgg
atgatgcagtgctttttcaataatatacgtcactatgcgcgtcgccatgccgaggtactg
atcacccaaaacggagagcagcagcagcagcagctgggcggacaactctactcgcacaag
acacaagtttctgtaagactgcagttcctatcatcgatattctcgacggtgggatccccg
aaaagcttccgcctaacgctggagcagcttgacgcgctatgggagtggctggcccacgat
ccggagtgtgccgactgctacttttcgtggctgcaggcccaggccaaaggcggtgatcag
catgctctgggcattgaagcacttcagcatttgtatttgaagaaactcccagagctgcga
cccgaggagttctctatggttgcgttgggactatttcaacagctctgtagcttcgcccgc
atcgccatggccgagtacgacaatcatagcgaccagatctcggcgagcgccagtgccgtt
ggcatgtaccatctttggaagatagcgttgcgtgcccagagcaacgatgtctccttggcg
gccatacagtacatcaacatgtactacatgggtcaacaattgcgcctggagaaggagttc
gtttcacagtgtatggaaaacctagttcaagcggccacggctttggaaagcatcgatgat
gagaatgctttgatgcgtgtccagcgtggcctgctcttgctgaacacccatttggatacg
ttccggcgtcgatatgcgtttcatctgcgccgctgggccatcgaaggcaaagggattgga
tcgcacagtaaccttaaaaatgagggagcgggtccaccactacgaatagtgctgcaacag
gcaggactttcggaaaaaagccttttgcagatgcacgcgtgtgacttaatcgccgacctc
aaggctgaggtgtccaagtggtgggagagccttcaaactggactagctgctcctgtgctc
ggtctgctgctcagcgatggaccgctacgcattatcacacagggacaggaattgacctcg
gattacgatgaacggagtctcggagatgctggtttcaaggataaccagatcgtctacgta
tcgttaggtggacgtggagccaggcgaaaggaatccaatttggagcatccgtcaatgctg
ccgcccccaccaaaggagtgtttgcccacggtgctcctgctgcagccaaagtacttcgag
aagctattttgcctgatgcagaccctgggcgatatgcaaccgcaagcgtcgactgtaaat
ccccagcaccacacaaaggcgcaattgctctcgcgacgcgtatgggatatcctcgccatg
ctgccaactaatccgcacattctagacgcctttaagagtctggttacggacctaagcgaa
ctcgagcagcttgatgctggcggagaggaggagcaactggccaccaagcgcaagcaaatc
aagcagaagttccgagatcttctcgacccgaacaacttgcaaaagttcatgtactccctc
catattgtggagagtctggccctaacaagttccagacgtggtgaatccaacggcaatgtg
gccatgggaaatacaccggaacaggtacgggtgaagaaatcctcgatgggaagacggaga
aatagcaacgagcagccgccaccgccgccgccagaagtcaagatgagcaaggagcaactg
tgcgagctggaggccccactgacgcccacaccctcgactggcttgcaggatgtggaaacg
gaggccagcagtagcagcggtggcgacaaagaaaaccaaccgaaacaacacagcaagcgt
cagaagaaaggcgaaacttttgaacaggaaaaggagcgcccagtgggttgctccacgccg
ccgtctccaactcctccgccaccagcactttcggtagtggaaagaggtgacaataagtgg
agtgaggcgttcgtcaaatgtggtggccttcgtcatctgtacgaaatctttagtgagggc
caactacaacaaagcgcacatcccaaggagttggctttaaatgaatggcgacacgattgc
ctggccagcctgctgcgcattctctggcttcttggattcgaggaactgcagtcggcggat
gcccatgttctaatgtcacgtccgcacccgtttatgctacagttgatggaggtaccacag
tgcctgacccgactctcatcgatccttaacgacgaagttcaccagcagcatcaggcttct
tcggccaatccactggtattcccctatcagttccagcacttgcgtactggcttttggggc
agggcccagctcatccagttcgctatgaacattctagtgagttttgtgcacgcctcagcg
gaagcgagaaggcttctctgggccccaactggtaccgatcactgtcgatggctgcagaag
ttcatcctggaggatcccgaaccggcggtacggcgtgagatatgcgctggtctttatcgc
atttgcttaggaaacgcacatagctatcgcctcttactagcaccactgctgcacaagctc
atcgccctgttgccattggccgagcagatgagctctggcaaccagcacacgcagtttttg
ctctcggaagagggcaaggatccctacggacccgcctgccgtgactacttttggctgctg
gccagattggtggatactctctccccggaaatggtggccgaggagcacatcgacattgaa
atgctgtgcgaaagcatctcgcagagcattctcacccgagagtattatgaactgcgccat
ggttaccaggacgatggcttggtgggtctcctaaatctcatgtccaatttgatcaagtac
gacaccacattcaagtacacacccaaggcgttatcctttattgagcaactgattggcttc
ctgtttgacatgccctcgccggcagatcgccagaagcccaagtgcaagtcggcgtcgtct
cgagcatctgcctacgatctgctggttgaactttgccgtggatgcgccacaaactatgca
tatctgcatggacgtctgttggcacagcacaaatccggacccaagcagccgtatccctgg
gactattggccgcgcgatgaaggcagagctgagtgcggatatgtggggctaactaatttg
ggagccacttgctatatggcctcttgcgtccagcacttgtacatgatgccacaggcgcga
gcagctgttttgcgagttccacccaacgccgcccgtaagcatgggcccacacttctggaa
ctacaacggatgtttgcctacctactggagtcggaacggaagtcttacaacccgcgaagc
ttctgccgggtgtaccagatggatcaccagccgctaaatacgggagagcaaaaggatatg
gcagagttctttatcgatttggtgtccaaactggaagatatgacgcctgacttgaagcac
ctggtgaaaaggctcttctgtggatccttgagcaataatgtcgtctccctggattgcggt
cacgtttcccgcacggccgaggacttttacacggttcgctgccaggttgcagatatgcgc
aatctgcaggaatccctggacgaagtcaccgttaaggataccctcgagggcgacaacatg
tacacctgctcgcagtgcggcaaaaaagtacgagccgagaagcgggcttgcttcaagaag
cttccccagatcttgtgcttcaacaccatgcgctacaccttcaatatggtcaccatgctc
aaggagaaggtcaacacgcacttttcctttccgctacgcctgaacatgtgtcactatgtg
gagaagaccttgatgccgcagcagtacaaagaggagcgagaaaggcgccaaaaggagaag
gaaggagcagatggtagtggcgatgggaatgacaacgaaaaggcagaggccacgctagat
gacgatattgaagaatgctacgagtacgaactggtgggcgtcactgtccacacgggcaca
gcggatggcggccactactacagctttataaaggagcggacgaagactagttaccatacg
cacgagcggtggtttcttttcaacgatgccgaagtgaagcctttcgatccctcacagata
gcggcggagtgctttggcggcgagatgacgagcaaaacctacgactcagtgacggagaaa
tatctggactttagtttcgagaagaccaactctgcctacatgctgttctacgagcgccga
ctgccagagcatctgcagcgccggcattccgagctgctggttacacccacgcccagtccc
acagtggaagagaagtccgaggcggaggagcccactaaaatggagacaagctctagcgaa
atcaaggcagatgtggatgtggaagtggaagttgaggagaaggacaaggagaagcctgcg
cagactgacacagaatctaaggaaacgcctgcaaaagaggagatcgcggatgacaaatcg
aagcaggatgagcctgaggaaaagaaaatcgaaaagcaatccagagagggcgaagagaaa
tcggaaacggacgaaaagcccacggagatgacgaccgtgagcactgaggaggaaaagcag
ccaacagccaattgtgataatcaccagcaaaacaacaatagcaacagcaaagccagcaac
gatcagcaaccatccacgtcgaaggctgcccagaagctacaactatttcgtccattgttg
aacaaggagctcgaggattggatttggcaggacaatcgacagttcctgcaggatcgcaac
attttcgagcacacatatttcaactttatgtggcagatatgtgggcacataccccaatca
ttaatatcagagacggacgtcacctgcatggcagccaagttgtctgtgtcctttttcatt
gagacttttattcatgctaaggaaaagcccactatggtgccctgggtggagctgctgacc
aagcagttcaatgccagccaagaggcctgcgagtggtttctgtcgcacatgtcgcaggag
ccctactggccggtccaggtgctaatccagtgtcccaaccaaatggtgcgtcaaatgttt
cagcgtttggtaatccatgtcatccagcaactacgtgcctcacatgctcatctgtatctg
gaagtggagacagacgaggatgacaaggagttaataggccaagcctcttgcgtcacccgt
ttcattggttcgctcatctcgctcctggagcacggtgcccgagcgaacctgcggcacttg
tccgagtactttggactgttgtgcgagttctcacggatgggagatgaggaagccatgtac
ttgctgcgcatcggtgtactcaagagcctggtcgacttctatctgggtcacaagcaaaca
gacagcatagacataagctctgacaacgaagacaactcctctgaagaggcgctgtccgtg
gagaagatgcgtccggcctcgctggacaagatgattgctctgtgcgccagcctagtggaa
agatcaagaggagccgacttccggctgcgactctcgcccaaagacttctctgcaatcgcc
ggcggcaagggttttccatttttgtaccaacaaataaaggacggcattaatccgcaccag
acaaagcatttaatacacgcgctttgtcgctgggatgagcgcctggccacgcagatcatt
ggcatgctcttcgcgtcggtaaccaagcacacggagctgtgcgcgccattcttcaagctg
ctaactctgctcaccgagacgcagggcggtccagtgggcctgccttgtttcacccagttg
atcctgccacgaatgtgggacgccgccgagtactgtccacagtcggtgctcgactggctc
tcgctgcaggccaccaagaacaagatcgcccacgcctggatacttcaatcggccgagaag
tggctcgagcaattcctgctggcccacgataacactcgtgttcggaacgctgccgccttt
ctgctggtggcactggtaccctcccagccattccgggccaacttccgcgcccactcgcaa
cacaagctgctggccctcaatccgcacagttatcgcgacataaatagcgatgcccaggcg
gtgctgcaccaggtgatcacgctgctcctgcgattgctgcgtccagcgcgcgtctatgcg
gatatcggagcccatggcacgaccaagctgaccgcgtactttaatctgctcagctattgt
atggtttcaaagactgaaaaactaatggcaagttcgtacatgcgctccctgtgggagctg
ttccatccacgcctctcggagcccagtgttccggcccatcacaataagcacgcactatta
accttctggcaccactcactggtggactgtccggagaatgctgcccaggtggccaactgc
ccggagattacgcgcaacattgcatttaactatatactggccgatcatgatgacgcggag
atagtcacctacaaccgttccatgctgcccgcctattatggactacttcgtctgtgctgc
gagcagagccgtgcactcacacgccaattgtcccagcatcagaatcttcagtgggcattt
aaaaacatcacaccgcatcccacgcagtacgcggccgccgtggacgagcttttcaagttg
atggctctgttcgccacccgtcatccggatgctagtgaacaggaaaagcttgatgtgacc
cagtttaggagggctgtgattgtgtcctacaccagtagtctggatgcacgtgtctcttgg
tccacgctgatcagtgctcttaagatactcgtggacaatgaggaggaccgcacgatggtg
atcttcaacggcggcattgagatgtgtttcgaggcgctgcacacgctacattccatgcac
cacgaggccaccgcctgccacgtggccggagacctattcgatctcttgggcgagatgcta
ctcctcctagccactcttcgaacccgcacagacagtcctgctcaaaagaagcagcagcaa
caacagcagcagctggagcaacagttgcagttgcagcagcaacagatgctgcagaaacaa
cagcagcagtcgcaaagccaaacgcaaacaccgcagtcgccgcagcaaaaggaaaagcag
ctgcagcaacaaatgcagcagcatctgcagctgcaacagttgcagcaaatgcagttccag
cagcaacacttcctgcgccagcaacatcaacactcggcgctggcaaaggcactgccggat
gcagtgaagcgactggctacgctactcaacaccttcaattcgccagagatcagtcgcatg
gccttggaggtgctcaaggagctggtgcgcaatcccagcctggaaaccattagtattctg
gcgcccattcttatcaactgtcatctgtccgtggcgaatgctcccaatgcgatcggtcct
ctgggaccgtactttccgcgtcgcggtgcgaagcatacgccttggccattgggagccaag
aactcaccccgtccaccgcggcccatggtacagatgtgcatcgctctggctgagctgaca
ccacgcggtctcgatgccgattacgacgttcaggtggagtccttttaccgaccctaccat
gactttatcgatgtcatgatgcgcatgtgcgtcaacacgggcactctgaacgacacgcta
gtcaagctgcaatgcttggtggccatcgagtccacgccgctgcacttcacctatttcccc
aaattctgggtgggcatacacaacaatgctctgacgcacaaatacgttgagctgctggtg
aaaaatcaactgttggtagagtaccttcacaatgtccttagggacgagcgaagcatgttg
aaggatgcctgcgttcgtgaatttctggagctctattatcacaaggttgccgcccagctg
ccagtggcccgtatgatctacacaatcaactatggtatgcactccaaggacgacattgat
gagctgtgtggcgatctgttcgccatccgaatcattgcccaggccactggagtgccggcc
tcagtgcgcaaggagttgcgaggatcgctgagggcgcttcagaacaagagcgagcggttt
aggaaggaatcggagagggagctatcatcatctccctatttgccagatccatttccgaac
aagaagcagaaacgtgactcgcaaaagatcaaggaaaaggagcaccctcagccggagagc
gagaaagagacctcaacggagaacgacaaaccatcagatgtttccatggaatccagcggt
aacgcggagcaagcaacggacagcacaaaaccaccaactcctgcaggcagcgacgatgag
cagatggacaaaacttcagttccctcgtccgatgacgagacagagttggaggacgagctg
cagccgacgcccaagcgcaacaagaaggcttcgaataagaagaccgcccaggatcgtgtc
aacgaggagcgcgagaagcgacttatcacgctgatcaccatggaatcatatatccagagc
atttttgccatccttaagagagatgccagtgtccccagttcgggagcgactaaggagccc
agtgaggaaccgtgtggcgaggcatccacttcggcggctgccgctgtaaagttatctcgt
cccaaaggagcctgtactccgccggagccaattaccgacgtaaacgatacgcgttgcaac
atagatactgagacagaggcggaggcggatgagcaatctccaaagacgagccagacaaat
ggtagccaacagaacgaatccccgccagcggcgaccagtgcagacactgcacccgcgaat
ccttcaccagctcccgcggccgccgttgcgtccacatcccaggcggcaagtccaacacag
atttag

DBGET integrated database retrieval system