KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5796Help
Entry
Dmel_CG5796       CDS       T00030                                 

Gene name
Ppox
Definition
Protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dme00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:96A14-96A14
AA seq 475 aa AA seqDB search
MTTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGEPGANTLELVEDLKLEVTPIRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKAVLRDLFTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGTLISRFEKNKTKDTKDGLFAERQPKLYAQAVKEKWAMYGLKG
GLENLPKTMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVEHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEAIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccgtgctgggaggcggattgagtggactatccgccggatactacctgttg
cggcgattcgggaagccgctgaccatctacgaggcctcgccccgtgtgggcggatgggtg
cggtcggagaatcgcaaggatcgcaacttcatcttcgagagcggaccgcgaaccatacgc
ccagttggtgagccaggtgccaatacgctagaattggtggaggatctgaagctggaggtg
actcccattcgacgcagtcatgtcgcagcacgcaaccgaatgctgtatgccaagggacag
ctctgcatgctgcccaacagtcccaagggtctcttcggcgtcctgcctcccttcacgaag
ccgctatacaaagcggttcttcgcgatctgttcacagcaagcaagaaagcgaagctggag
gatgagagcatctacagtttcgctgagcggcggtttggtaaggagatagccgactacgcc
atcagtcccatgatctgcggtatttgcgccggtgacgcgcgagaaataagtgtgcgcttc
ctgatggaggggctctttgaaaaggaacagaagtacggaggagtgctcaagggcacactc
atttcccgctttgagaagaacaagaccaaggacaccaaggatggactatttgccgaaaga
cagcccaagctgtatgcgcaggcggtaaaggagaagtgggccatgtacgggctgaaaggc
ggtctggagaacctacccaaaactatgcgaaagtacttaggtgagcgggatgtgaacgtg
cagctaagcaacgaatgccggaacctgaccttcagcagctccggggttcgaatgaacatc
aaggatgccgaagttccggtggagcatgtggtcagctccctgcccgcctacaaactcgcg
cccctggtaaagcagcagcatccctcgctgagcgcccaacttttgagcattccgtacgtg
gatgtgctggtagtgaacatgcagttccccggcaagctactcaaacaagacggctttgga
ttgctagtgccgccagtggaaaagttacctctgctcggcgtcatcttcgacagctgctgc
ttcgacatgggcgagaacactgtgcttaccgtgatgatgggtggccattggttcgaccag
tggttcggtgatcgtccaagccccaagcagattcttgacttagccaccagccatgtgcag
aaaatgctgcagatacgcgaggaacccaaattcagtcgagtgcacacgctgcacaagtgc
atcccgcagtacactgtgggccacaagcggcgcgttgaagccattcggaactacatcaag
acctacaaactgccactgtctgtctgtggagctgcatacgatggcgtgggcatcaacgat
gttatcctatccgcccggcgacaagtggaagccatacccttgtcctaa

DBGET integrated database retrieval system