KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5798Help
Entry
Dmel_CG5798       CDS       T00030                                 

Gene name
Ubpy
Definition
UBPY ortholog
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmel_CG5798 (Ubpy)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG5798 (Ubpy)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG5798 (Ubpy)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:93C1-93C1
AA seq 367 aa AA seqDB search
MICVAGVRLQLPTAPPTYSIYSSIFPLRRGRGLTGLKNLGNTCYMNSILQCLSNTPQLTE
YCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVD
QQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKST
VKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKRDAI
KKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPK
TYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFYTWL
PPMQVPL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtgtagcgggcgtgaggctccagctgccaacagctccgcccacctacagcatt
tatagctccatctttccgctgagacgaggtcgtggactgactggactgaagaatctgggc
aacacctgctatatgaacagcatactgcagtgcctgagcaacacgcctcagttgaccgag
tactgcatttcggacaaatacaagaattacatcagcagaagcaacaagactaatggccag
gtgatcgaagaggtggctgcactcatcaaggagctctggaatggacagtacaagtgtgtg
gccagccgagatttgaggtacgttgtgggccagtaccagaagatcttccgcggcgttgac
cagcaggactcacacgaattcctcaccatcctgatggactggctgcactcggatctccag
accctacatgtgccccgtcagcgggagatgatcagtgcgtcggaaaaggcttggctggaa
tttaccaaggcgaaggagagcatgattctgcatttattctatggccaaatgaagagcact
gtgaaatgtgtggcctgccacaaggagtccgccacgtacgagagtttttctaatctcagc
ctggagctgccgccaaactcgaatgtatgtcagctgaaccagtgcatggacatgtacttc
agtggagaaaggatccatggctggaattgtcctagttgtaaaacgaaaagagatgccatc
aagaagctggatatatcgaagctgccacctgtgctggtggtgcatcttaagcgcttctat
gcggatcccagtaactctggctcgtacatgaagaagcagaactacttgcgcttcccgctc
gagaacttggacatgaatccctacatagcacgggcggaatcgcgggcggtaacacctaag
acctaccagctgtacgccgtatccaatcactacggcaccatggaaggcgggcactacacg
gcattttgcaagagcgccaactacggaaaatggttcaagttcgacgatcaggtcgtctcg
gcgttggactcctctaacgtggtttctagcgctgcatacattcttttctacacctggctg
ccacccatgcaggtgcctctgtag

DBGET integrated database retrieval system