KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5809Help
Entry
Dmel_CG5809       CDS       T00030                                 

Gene name
CaBP1
Definition
calcium-binding protein 1 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dme04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:35F12-35F12
AA seq 433 aa AA seqDB search
MRQLASILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQS
LVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTA
KAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVE
FFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSK
RASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPH
ILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNF
KKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEED
IDLSDIDLDKDEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaactggcgagcattttgttgctggcatttgtcgtgggcagcgttagtgccttc
tattcgcccagcgatggcgttgtggagctgacgccctcgaatttcgaccgggaggtgctg
aaagacgacgccatctgggtcgtggagttctatgctccatggtgcggccattgtcagagc
ctggtgcccgagtacaagaagctggccaaggcattgaagggagtcgtgaaagtgggctcc
gtgaatgccgatgcggacagcacgctgagtggccagttcggtgtacgtggctttcccacc
atcaagatctttggcgccaacaagaagtcgcccacggactacaatggtcagcgaaccgct
aaggccatcgctgaagccgctctggcggaggtcaagaagaaggtgcagggtgtcctgggc
ggcggcggtggatcgtcttccggcggttccggcagctcgtccggcgatgatgtcatcgaa
ctcaccgaggacaactttgacaaactggtcctgaactccgacgacatatggctggtggaa
ttcttcgccccctggtgtggtcactgcaagaacctggcacccgaatgggccaaggccgcc
aaagaattgaagggcaaggttaagttgggcgccctggatgccaccgcgcatcagagcaag
gccgccgaatacaatgtgcgtgggtatcctaccattaagttcttccctgcgggctccaag
cgagccagtgatgcccaggagtatgatggcggacgcactgcctcggatattgtatcctgg
gccagtgacaagcatgtggccaatgtgccagcacccgaactcatcgagattatcaatgaa
tcgacttttgaaactgcctgcgaaggaaagccattgtgcgtcgtgtccgttctgccacac
attctcgactgcgatgccaagtgccgcaacaagttcctcgacacattgcgcaccctgggc
gagaagttcaagcagaagcaatggggctgggcctgggcagaaggtggccagcagttggcc
ctggaagagtcgctcgaagtgggcggattcggctatccggccatggctgtggtcaacttc
aagaagatgaaattctccgtgctcaagggctccttctccaaggacggcatcaacgagttc
ctgcgcgacatctcctacggacgtggccacacggcgcctgttcgcggagccaaaaagccg
gcgattgtgtccgtggatccttgggacggcaaagatggccaactgcccaccgaggaggac
atcgatctgagcgacatcgatctggataaggacgagctgtaa

DBGET integrated database retrieval system