KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5871Help
Entry
Dmel_CG5871       CDS       T00030                                 

Gene name
Oga
Definition
O-GlcNAcase (EC:3.2.1.35)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:93C6-93C7
AA seq 1019 aa AA seqDB search
MADEAGSQADGKRQFICGVIEGFYGRPWTTEQRKDLFRKLKSMGMGSSPSYMYAPKDDYK
HRAYWRELYTVEEADHLSSLIAAAKEAGITFYYALSPGLDMTYSSPKEIATLKRKLDQVA
QFGCEAYALLFDDIESELSKADKEVFQTFANAHVSVTNEIYTHLGSPRFLFCPTQYCASR
AVPTVQESEYLNTLGSKLNNEIDILWTGDKVISKNISLESIQEITEVLRRPPCIWDNLHA
NDYDQKRIFMGPYSGRSPELIPHLRGVMTNPNCEFYGNFVAIHSLAFWSRCSLDSKVNSS
LSADIKLETENDDDLPAEFLSKNVYHPRLALKNAITEWLPEFFMKKEAWGPITKPQPQVQ
MVMPIIPIIPSINTCMSLTTTTTTSTSSRTVPPTVNTTQLQALADVCVVTSSLTPISNPV
MNSLVSPTKVITNDDIINPIPTTAASNIELPKKIPISVVPVPIMETKSVEASVELALDNA
VFDDNEIEPNSDSVKERLELEVNLEGKQEPVANLSVDTMLDDDSLSPLSGVVNEPMECSS
SITSQVSPREEEAIKVVADDVLMESVNDVHSMHVESGTSSPISNAEMREETEAQSDRTND
NNTIEGEGITVDDLVLLCDLFYLPFEHGSRGHKLLVEFNWLKGNANVILQDRSAGGGGDA
IKSDKPEVSEWHQRREQFDQLCSAVVELLIKIANCPNKEICHELYSYMWDISGALSLLNC
YVKWLALGHFPQNTSSYTEGSYTWFSKGWKEAFMSGDQEPWVFRGGLIADLQRLMPVDSG
NDLFVYKLPEQPTANYYLLRPYCNSDEQQVNDLCTRLYLQWRGELDGGRHIPFPLPANVP
NIVADGLIGGYLTLSPQLCIVAYDESNRIIGYSCAALDVNIFRRNLELCWYTELREKYSR
DICPLEGGEEVVQLVTSLVESYHDSSGNGALDQCPVEVSGSFPAVLISGTLREAEERDSG
ITKRMLTVLLAALRANGCFGAHVRVPQQDVAQVNFYSRIGFVDVYREEATKCIYMGRRF
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagcgggcagccaagccgatggcaagcggcagtttatctgcggcgtgatc
gagggattctacggccggccgtggaccacggagcagcgcaaggacctgttccgcaagctg
aaatccatgggcatggggtccagtccttcgtacatgtacgcaccaaaggacgactacaag
caccgcgcctactggcgagagctatacaccgttgaggaggcggatcacctttccagtctc
attgcagcggccaaggaggcgggcatcaccttttactacgcgttatcgcccggactggac
atgacctacagcagccccaaggagatcgcaacgttgaagcgcaagctggaccaggttgcg
cagtttgggtgtgaggcctacgccctgctctttgacgacatcgagtcggagctctcaaag
gcggacaaggaggtctttcagacgtttgctaacgcgcacgtgtcggtgaccaacgagata
tacacgcatctgggcagccccaggtttctcttctgccccacccagtactgtgcctcgcga
gcggtgccaacggtccaggaatcggagtacctcaataccctgggctccaagctgaacaac
gagatcgatattttgtggacgggggataaggttatctccaagaacatatcccttgagtcg
attcaagagattaccgaggtgctgcgccgtccgccgtgcatctgggacaatcttcatgcc
aacgactacgaccagaagcgaatcttcatgggaccgtacagcggtcgatcgccggagctt
attccccacctgcgtggtgttatgaccaatcccaactgcgaattctatggcaattttgtt
gccatccattcgctggccttctggtcgcgctgcagcctggactcgaaagtgaacagctcg
ctaagtgcagacataaaactggagactgaaaacgatgatgacctaccggcggagtttctc
tctaagaacgtttaccacccacgcttggctctcaaaaacgctataacggagtggctaccg
gagttcttcatgaaaaaggaggcctggggaccgatcaccaagccccagcctcaagtccaa
atggtgatgcccattattcccatcataccctccataaatacctgcatgagtctcaccacc
accacaaccacatcgacgagctccaggacggttccacccacggtcaacaccactcaactt
caagctctggctgacgtttgcgttgttacctcttccctgactcctatctcaaatccagta
atgaactccctggtctcacccacaaaagtgatcacgaacgatgacatcatcaatcccatt
ccgaccacagcggccagcaacattgaactacccaagaaaataccgatctccgttgtccca
gtgcccattatggagacaaagagtgtggaggcttccgtggaactggctttggacaatgcg
gttttcgatgacaatgaaattgagcccaatagtgattccgtgaaggagcggctagagctg
gaggtgaacctagaggggaagcaggaaccggtggccaatcttagtgtggacacaatgctg
gacgatgacagtcttagtcccctaagtggcgtagtcaatgagccaatggagtgcagcagc
agtatcacatcacaggtctctccaagggaggaggaggccattaaagtggtggccgacgat
gttctcatggagtccgttaacgatgtgcatagtatgcatgtggagagtgggacttcgtcg
ccgatctcaaatgcggaaatgcgcgaggaaactgaagctcagtctgataggactaacgat
aataataccatcgaaggcgaaggaataaccgttgacgatttggttcttctctgcgacctg
ttctatctgcccttcgaacatggcagtcgcggccacaagctgctcgtggaattcaactgg
ctgaagggcaacgctaatgtgatactgcaggaccggtctgccggcggcggaggcgatgca
attaaatcagacaagccggaggttagcgagtggcaccagcgtcgcgagcagttcgaccaa
ctctgcagtgctgtagtagagctcctaattaagatcgccaattgcccgaacaaggagatt
tgccacgagctgtactcgtatatgtgggacatctccggcgccctatctctgctcaattgc
tatgttaagtggctggctctcggccatttcccgcaaaatacgtcttcctacacagagggc
agctacacatggtttagcaagggctggaaggaggcgttcatgtctggtgatcaggagccg
tgggtctttagaggcggcctcattgccgacctgcaacgcctgatgcctgtggactcgggc
aacgacctgttcgtgtacaagcttccggaacagcccacggccaactactatctcttgaga
ccttactgcaattcggacgaacagcaagtcaacgatttgtgcactcgcctgtatttgcag
tggcggggagagctggacggaggcaggcacattccgttcccgctgccggcgaatgtgcca
aacattgtggcggatgggctgatcggtggatatctcaccctcagtccgcaactgtgcatt
gtggcctacgacgagagtaaccgtatcattggatattcatgcgccgccctggatgtcaac
atatttcgacgcaacctggagctgtgctggtacacggaactgcgtgagaagtactctaga
gatatttgtccactggagggtggcgaggaggttgtacagctcgtcacctcccttgtggag
agttatcatgacagcagcggtaacggggctctggaccagtgtcccgtagaggtgagcggc
tccttccctgccgtgttgatctccggaactttgcgcgaagcggaggagcgcgactcggga
ataaccaagcggatgctcaccgtacttctggccgccctgcgtgcgaacggctgctttggt
gctcacgttcgcgttccgcaacaagatgtcgcccaggtgaacttttattccagaatcggt
ttcgtggatgtctatcgcgaggaggccaccaagtgtatttacatgggtcgccgtttctag

DBGET integrated database retrieval system