KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5946Help
Entry
Dmel_CG5946       CDS       T00030                                 

Definition
CG5946 gene product from transcript CG5946-RB (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG5946
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dmel_CG5946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:68E1-68E1
AA seq 316 aa AA seqDB search
MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLP
LIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYV
DLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDEL
AQKHPDQFKIWYTVDKANEAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCI
PGLERLGHRAEQRFSY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcgttgaaagcaattttgtgccactcgccgtgggtgtggtagccgtactc
gccggcgccctgatcgtccactatctgctgaataagaagtccacgaaaccacgccgggaa
cccaatcgcaccgctcggctgcgcacacttgtggatcccaatgacaagtacctgctgcct
ctcatcgaaaaggagaatctgagccatgacactaggagattccggtttggattgccctcc
aagcagcatgtccttggcctgcccgttggccagcacattcatctgatcgccaccatcgac
aatgagctaataattcggccatacactccgatatcgtctgatgaggatgtgggctacgtg
gacctagtcgtcaaggtgtacttcaaggattcgcatcccaagttcccggccggcggcaaa
atgacacaacacctggagcagctcgagttgggggacaagatctcgttccgtggtccctcg
ggtaggctacaatatctcggcaatggcaccttctccatcaaaaagttgcgcaaggatcct
ccaaagcacgtgaccgccaagcgggtcaacatgattgccggcggcactggcattactcca
atgcttcaattggccagggaagttctcaagcgcagcgataaggataagactgaactggcg
ttgctgttcgccaatcagagcgaaaaggacattctactgcgtgcagagttggacgaactg
gcccagaagcatcctgaccagttcaagatctggtacacagtcgacaaggcaaacgaagcc
tggtcctacaacactggccacgtgaacgatgatatgatgcagcagcatctgtatccgccg
ggcgaggacacgctgtgcctactgtgtggtcctccacccatggtgaactatacatgcatt
ccgggcctagagcggcttggtcacagggccgagcagcggttcagctattag

DBGET integrated database retrieval system