KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6027Help
Entry
Dmel_CG6027       CDS       T00030                                 

Gene name
cdi
Definition
center divider (EC:2.7.10.- 2.7.11.-)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:91E4-91F1
AA seq 942 aa AA seqDB search
MSLNQHSGPGPPSEICGLSVDQVDSSAASPFIWPSTAGMCTTATTVTTSTNGDATAEAPV
KHQPLHNGGWIGNGLPPAPVTRTISSDRLVTGSSCRALRTAVSALYSVDDFVKEKIGSGF
FSEVYKVTHRTTGQVMVLKMNQLRANRPNMLREVQLLNKLSHANILSFMGVCVQEGQLHA
LTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRDLTSKNVLIRNL
ANDQYEAVVGDFGLAAKIPVKSKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCE
IIARIEADPDMMPRTASFGLDYLAFVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATK
KLTLLLEKYEHESSAGASPLSSLELINCSPGGSDSENVTLTPRASVPTVATICTAPAGTL
TPRHLQEVDEDGFRFPSKKSASAALPGTPNGSAGSSGFDDHILKSRVRRATQKLEAEILL
HRRSLSENIIHFPMHTSPSDKARCHQMQRQRSSTHSPTPPRQLSSVQLPATSIPDPPPLP
KPVPAVLTLRKVGDPQYKPTSEKDHNGSKPNPFEALAQLRGVKKILDANPKTYAAGVGDL
FSSCFEMLAPFFKELAAMQSKAGAQGGGTSTEETSTGNKASAATPSEPKSLPVSPHMTRK
YSAIELRLPQRISNAAPPAVTSAPPPSIALPTDEDDCDDCNSEGEDPDGGGNCADAESSS
DDSAVRPSTVPTARKYRANSLYAHPLFRGSNGTSMKSTSTGEFESPTLLKASASTITLTA
SVGATNSCEDLTESARKSKEQASSGATAAVQALPTPMSGCSTRLVETPVSVSSCTDLELD
ELKNTCDLNELKNSCEQLPLKTNLTRRDSIESGFFSCFNEESDAAITNNSFGRQLNGIGS
LGFGCGGGGNSSNCCYEKLKTQLMLDACVSADSEIKLNTATV
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaatcagcacagtggacccggcccgccgtcggagatctgcggattatcggtg
gaccaggtggactcatcggccgcctcccctttcatctggccgagcacagcgggtatgtgc
accaccgccaccaccgtcacaacatcgaccaatggagacgccaccgcggaagcaccagtg
aaacatcagccgctccacaacggcggctggatcggaaatggtcttccgccggcgcccgtg
acgcggaccatatcatcggatcgcctggtcaccggcagctcgtgtcgggcgctgcgcact
gccgtctcagcattatactccgtggatgacttcgtcaaggagaaaattggatcgggattc
ttctcggaggtttacaaggtcacacatcgtacaaccggccaggtgatggtgctcaagatg
aatcagttgcgggccaatcgaccgaatatgctgcgggaggtgcagctgttgaataaactt
tcgcatgcgaatatattgagcttcatgggcgtttgcgtgcaggagggccaactgcacgcc
ctgaccgagtacatcaacggcggctccctggagcagctgctggccaacaaggaggtggtg
ctcagcgccacgcagaagataagactggcgctgggtatagcgcgcggcatgtcctacgtt
cacgacgcgggcatctttcacagggatctgacgagcaagaatgtacttattcgcaatctg
gccaacgatcagtacgaagctgtagtgggtgactttggtctagccgcaaagataccagtc
aaatcaaaatcacgccttgagacagtcggctcaccgtattgggtcagtccggagtgcctg
aagggccagtggtacgatcagacaagcgatgtcttctcctttggcatcattcaatgcgag
atcatagcccgcatcgaagcggacccggatatgatgccgcgcacggcgtcgtttggactg
gactacctggcatttgtagaattgtgtccgatggacactcctcctgtgtttttacgtctg
gccttctactgctgtctgtacgatgccaagagccgacccacgttccacgatgccaccaaa
aagttgactttgctgctggagaaatacgagcacgagtcgtcggccggagcaagtccactc
agttccctggagttgatcaactgctcaccaggaggcagcgattcggagaacgtaacgttg
acaccccgagcatcagtacccacggtggccactatttgtactgctcctgctggcacttta
acaccgcgccatctacaggaagtggacgaggacggcttccgatttccaagtaaaaagtct
gcttcggctgcgcttccgggcacgccaaatggatctgctggaagcagtggctttgatgat
catatactgaagtctagagtgcgacgggctactcagaagttggaggccgagatcttgttg
caccggcgttcgctaagcgagaacatcatccacttccccatgcacacgtcgccaagtgac
aaggcgcggtgtcatcagatgcagcgacagcgctcctcaacacactcaccaacgccccca
aggcagctttcctcggttcagttgcccgccacgtctattccagatcccccaccgcttccc
aagcccgttccagcggtactcacactgcgcaaagtgggcgatccacagtacaagccgaca
tctgaaaaggatcacaacggctctaaacccaatccgtttgaagcgctggcgcaactgcgt
ggtgtcaagaaaatcctggacgccaatccgaaaacctatgcagcaggggtgggagatcta
ttcagctcatgcttcgagatgctagcgccgttcttcaaagaactggccgcaatgcagagc
aaagcgggggctcagggcggaggaacgagtacggaggaaacatcaacgggtaacaaggct
tcggcagcaacgcccagtgaaccaaagagcctgccagtgtcgccgcatatgacgcgcaaa
tacagcgccatcgagcttcgacttcctcagcgaatcagcaatgctgctcctccagcagtt
accagtgctccaccaccatcaatagcattgccaaccgatgaggatgactgcgatgattgc
aattcggaaggtgaggatcccgatggcggtggcaactgtgcagatgcggaatcaagcagc
gatgacagcgccgtgcgtccgtccactgtgccaaccgctcgaaaataccgcgcgaattcc
ttgtatgcgcatccgctttttcgcggctccaatggcaccagcatgaaaagtaccagtact
ggtgaattcgagagtccaactctactgaaggccagcgcatctacaatcacgttgactgcg
tcagtgggtgcgaccaattcgtgtgaggatctgactgaaagcgccagaaaatcaaaagag
caagcgagtagcggtgcaacagcggcggtgcaggctttgcccactcccatgtctggctgc
tccaccaggttggtggaaaccccggtgtccgtttcatcctgcactgatcttgagctcgac
gaactgaaaaacacctgcgatctgaacgaattgaagaactcgtgtgagcagcttcccttg
aagacaaacctaacgaggcgggactctatagaaagtggcttcttctcgtgctttaacgaa
gagtccgatgcggcgataaccaacaacagtttcggacggcagctgaacgggattggatcg
ttggggtttggttgcggcggcgggggcaacagtagcaactgctgctatgagaaattgaag
acgcagcttatgctcgatgcatgcgtcagcgcagatagtgaaatcaagttaaacacagcc
acggtataa

DBGET integrated database retrieval system