KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6097Help
Entry
Dmel_CG6097       CDS       T00030                                 

Gene name
rt
Definition
rotated abdomen (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dmel_CG6097 (rt)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dmel_CG6097 (rt)
Glycosyltransferases [BR:dme01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dmel_CG6097 (rt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:68C13-68C13; 3L:3-37 cM
AA seq 886 aa AA seqDB search
MSATYTNTITQRRKTAKVRQQQQHQWTGSDLSGESNERLHFRSRSTNSMQQHTAISNSPS
PLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPTATPTPVATPKQASPSPTS
DRSRSLSRSPSPSRSRSLSCQKQIDKNSAGAASAEERKTANASSQPFTVNLRIDLFSWTL
FLLAFGTRFYKLATPPHIVFDELHYGKYISMYMRNIFFFDQHPPLGKQLIAGLVSLAGYD
GNYTFTRIGEPYSPEMPIFWFRFLPAMCGSLLAPAVYNLLLEAKLSRWSSALGGLLVVLD
NSLLTQSRFVLMESMLLLATTVGIACLLRFQRSRLGSLEWFFTGTAAAVCLGAAGTVKYV
GFLALGLAFYLLCRHLWQLLYDAGLTDRQLWMHAISRLLIFVGIPLAVYLGVFYIHFKTL
HRAGPHDSIMTSAFQASLDGGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPV
RYPDKRGSSHQQQVTCYSFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSR
ALNSHDVAAAMTPQCQEVSCYIDYEIKMAGELLWRVEILNRDSEGDIWHAIKSEVRLVHV
STEASLKFSGRQLPEWGFNQHEVVADREKAIHEDAIWNVEEHRYTQTEDHRERERQMLTA
EMIPTKRTRISFWAKLLELQSKMLFQTKSVPNHMYSSMPHEWPLMDKGIAYWLDSQSSAQ
IYLLGNILLWYTATMGILVYAGLLAFYAMRRQRLCFDISEQEWQRFVLAGDTFFMGYVMH
YIPYFCVDRTLFLHNYLPAFVFKLLLLCFVVEHLDYLLRRFCTGRGVHLVRLYRLMLILW
LVGVLSIFSKFIPFSYGARKMTLNEVRSLRWKDTWDFVLHKNHHLY
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacctacaccaatacaattacacagcgccgcaagacggccaaagtgaggcag
caacaacaacaccaatggacaggcagcgatttgagcggcgagtcaaacgaaagacttcac
tttcgcagccgttcaacaaactcgatgcaacaacacacagcaatcagcaactcaccttca
ccactgtgctgtaacggcgctcgtgctttaacaatgctcaattgctgcgtcgacgtcaac
tgtcatttgaatgcgccgctccgcggcagcgttaaccggcacacgacgccaacgccgacc
ccgactgcgacgccaacgccggtagcgacgccaaaacaagcctccccctcgcctacctcc
gatcgttcgcgctccctctcacgctcgccttcgccgtctcggtctcgctcgctctcctgc
caaaaacaaatcgacaagaacagcgctggcgcagcatccgcagaagagagaaaaaccgct
aatgcgagttcgcagccatttaccgttaacctgagaatcgatctcttcagttggacactc
tttctcttggccttcggcacgcgtttttacaagctggcaacgccgccgcacatcgtattc
gatgaactccactacggcaagtacatttccatgtacatgcgaaacattttcttcttcgat
caacatccaccgctgggcaaacagctgatcgccggactggtcagcctggctggttacgat
ggcaattacacctttacccgcattggagagccctattccccggaaatgcccatcttctgg
ttccgatttctaccagccatgtgcggcagtctactggcccccgccgtttacaatcttttg
ctggaggcgaagctcagtcgctggtcatccgctttgggtggcctgcttgtggtcctggac
aactcattgctgacgcaatcccgttttgttctgatggaatcaatgcttctgctggccacc
acggtgggcatcgcctgtttgctacgcttccaacgaagtcgcctgggcagcctggaatgg
ttctttactggaacggcagctgccgtctgtttgggagccgccggaaccgtcaagtacgtc
ggattcttggcactggggctagccttttatttgctgtgtcgacacctgtggcaactgctc
tacgacgccggtctcaccgatcgccagctatggatgcatgccataagtcgcctgttaatc
tttgttggaattccattggcggtctacttgggagtcttctatatccacttcaagacgctg
caccgggctggaccgcatgatagcatcatgactagcgcgtttcaggcctcgttagatgga
ggattggcatcgatcacaaaaggacagccattggcagtggttcatggatcccaaatcaca
ctacgacacacccacggacgcacctgttggctgcactcgcatgcagctgtctatccggtg
cggtatccggacaagagaggctcctcccaccagcagcaggtcacctgctactccttcaag
gatgtgaacaactggtggctggttaagcgaccaacaaaggagaacctggtggtgggtgat
gagccggatatcattcggcacggtgaaattattcagttggtccatggaattacgagccga
gctctgaactcacacgatgtggctgcggcaatgacgccgcagtgccaagaagtcagctgc
tacatagattacgagatcaaaatggccggtgaactgttgtggcgcgtggagattctgaat
cgcgattccgaaggtgacatttggcatgccatcaagtcggaggtccgcctcgttcacgtg
tccacagaagcctccttgaagttcagtgggcgccaacttcccgaatggggtttcaatcag
cacgaggtggtggcggatcgtgaaaaggcaatacatgaggatgccatttggaatgttgag
gagcaccgctatacacagactgaggatcatcgggagcgagagcgccagatgctaactgcc
gagatgatacccacaaagcggacgcgcatctcgttctgggccaagctactggagctacaa
tccaagatgctgttccaaacgaagtcagtgccaaatcacatgtacagctcgatgccgcac
gagtggccgctaatggacaagggcatcgcttattggttggactcacagtcgagtgcgcag
atctatttgctgggaaacatactactctggtacacagccaccatgggaatacttgtctat
gccggattactcgccttctacgcgatgcggcggcaacgtctttgctttgatatttcggag
caagagtggcagcgattcgtattagctggtgacaccttttttatgggctacgtgatgcac
tatattccgtatttttgtgtggatcgtacactcttcctgcacaattacttgccagccttt
gtgtttaagttacttttattgtgctttgtcgtggagcatttggactatctgctcaggcgc
ttctgcaccggacgtggtgtccatctggtgcgcctttatcgcctcatgctaatcctgtgg
ctggtgggcgtgcttagcattttctcaaagtttataccattcagttatggtgcgagaaaa
atgactttaaatgaggttcgcagtcttcgatggaaggatacctgggactttgtcctgcac
aagaaccaccacctgtactga

DBGET integrated database retrieval system