KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6117Help
Entry
Dmel_CG6117       CDS       T00030                                 

Gene name
Pka-C3
Definition
cAMP-dependent protein kinase 3 (EC:2.7.11.- 2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG6117 (Pka-C3)
   04340 Hedgehog signaling pathway
    Dmel_CG6117 (Pka-C3)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmel_CG6117 (Pka-C3)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dmel_CG6117 (Pka-C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:72B1-72B2
AA seq 500 aa AA seqDB search
MSTATCARFCTPLSSGTAGSTSKLTTGNGSGNTMTSAYKIPSNNSTTANDSSNTETTFTF
KLGRSNGRSSSNVASSESSDPLESDYSEEDPEQEQQRPDPATNSRSSSTATTTTTSSADH
DNDVDEEDEEDDENEGEGNGRDADDATHDSSESIEEDDGNETDDEEDDDESEESSSVQTA
KGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNER
NILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVS
ALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQS
KGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKL
LVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPE
KDWKPAKAVDQRDLQYFNDF
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggcgacttgtgcccgcttctgcacgcctttgtcatccggcacggcaggatcc
acatcaaaattgacaaccggaaacggaagcggcaacacgatgacgtcggcgtacaaaatt
ccatcaaacaacagcacaacagcaaatgacagcagcaacacagagacaacattcacattc
aaattgggccgctcgaacggccgaagtagcagcaatgtagcctcaagcgagtcatccgat
ccactggagtccgattacagcgaggaggatccggagcaggagcagcagcgacccgatccg
gcgaccaacagccggagcagcagcaccgccaccaccaccaccaccagttccgctgaccat
gacaatgacgtcgacgaggaggatgaggaggacgacgagaacgagggggagggcaacggc
cgggatgcggatgacgccactcacgattccagcgagagcatcgaggaggacgatggcaat
gaaaccgatgacgaggaggacgacgacgagtcggaggagagcagcagcgtccagaccgcg
aagggagtgcgcaaataccacttggacgactaccagataatcaaaacagtgggcacgggc
acctttggacgagtttgcttatgtcgcgatcgcatttcggagaagtactgtgccatgaag
attctggccatgaccgaagtcattcgtctcaaacagattgagcacgtcaagaacgagcgg
aatatattgcgcgaaatacgacatccgtttgtcatcagcctggaatggtccacaaaggat
gactcaaatctgtatatgatcttcgactatgtctgcggcggcgagctgttcacatatctg
cgaaatgcgggaaaattcactagtcaaacctccaacttctatgcggctgagatcgtcagt
gccctagaatacctgcactcactgcaaattgtttatcgcgatctgaagccagagaatctg
ctgatcaatcgggatggtcatttgaagataaccgattttggatttgccaaaaagctgagg
gatcgcacttggacattgtgtggaacgcccgagtatatagcacctgagataattcagtcc
aagggtcataataaagccgtagattggtgggcattgggagttctcatctacgaaatgctc
gtgggatacccaccattctacgatgaacagccctttgggatctacgagaaaatattgagc
ggtaaaattgagtgggagcgacatatggatcccattgccaaagacttgatcaaaaagctg
ctggtgaatgatagaaccaaacgactgggcaacatgaagaatggcgccgatgacgtgaag
aggcatcgctggttcaagcacttgaattggaatgacgtctacagcaagaaacttaagcca
ccaattttgcccgatgtacatcacgatggggataccaaaaattttgatgattatcccgaa
aaggattggaagcccgccaaggcagtagaccaaagagatttgcagtacttcaatgatttc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system