KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6117Help
Entry
Dmel_CG6117       CDS       T00030                                 

Gene name
Pka-C3
Definition
(RefSeq) Protein kinase, cAMP-dependent, catalytic subunit 3
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmel_CG6117 (Pka-C3)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   Dmel_CG6117 (Pka-C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:72B1-72B2
AA seq 583 aa AA seqDB search
MDLWHIFLERILVACRVSASVFANFGCGLYSSWKLICGDHDSASGLRAGLATPTQRGKAT
GDNGTTGTPARTIGKPQARIATAMSTATCARFCTPLSSGTAGSTSKLTTGNGSGNTMTSA
YKIPSNNSTTANDSSNTETTFTFKLGRSNGRSSSNVASSESSDPLESDYSEEDPEQEQQR
PDPATNSRSSSTATTTTTSSADHDNDVDEEDEEDDENEGEGNGRDADDATHDSSESIEED
DGNETDDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEKYC
AMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELF
TYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAK
KLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEK
ILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKK
LKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtggcatatatttttggaacgtattttagtggcttgcagagtcagcgcaagt
gtcttcgcaaatttcggctgcggtttgtattccagctggaagctaatctgcggcgaccat
gactcggcttccggtctgcgggcaggacttgccacgcccactcaaagaggaaaagcgaca
ggagacaacgggacgacaggaactccggcaaggacaatcggaaaaccgcaggcgaggatt
gcgacagcgatgtccacggcgacttgtgcccgcttctgcacgcctttgtcatccggcacg
gcaggatccacatcaaaattgacaaccggaaacggaagcggcaacacgatgacgtcggcg
tacaaaattccatcaaacaacagcacaacagcaaatgacagcagcaacacagagacaaca
ttcacattcaaattgggccgctcgaacggccgaagtagcagcaatgtagcctcaagcgag
tcatccgatccactggagtccgattacagcgaggaggatccggagcaggagcagcagcga
cccgatccggcgaccaacagccggagcagcagcaccgccaccaccaccaccaccagttcc
gctgaccatgacaatgacgtcgacgaggaggatgaggaggacgacgagaacgagggggag
ggcaacggccgggatgcggatgacgccactcacgattccagcgagagcatcgaggaggac
gatggcaatgaaaccgatgacgaggaggacgacgacgagtcggaggagagcagcagcgtc
cagaccgcgaagggagtgcgcaaataccacttggacgactaccagataatcaaaacagtg
ggcacgggcacctttggacgagtttgcttatgtcgcgatcgcatttcggagaagtactgt
gccatgaagattctggccatgaccgaagtcattcgtctcaaacagattgagcacgtcaag
aacgagcggaatatattgcgcgaaatacgacatccgtttgtcatcagcctggaatggtcc
acaaaggatgactcaaatctgtatatgatcttcgactatgtctgcggcggcgagctgttc
acatatctgcgaaatgcgggaaaattcactagtcaaacctccaacttctatgcggctgag
atcgtcagtgccctagaatacctgcactcactgcaaattgtttatcgcgatctgaagcca
gagaatctgctgatcaatcgggatggtcatttgaagataaccgattttggatttgccaaa
aagctgagggatcgcacttggacattgtgtggaacgcccgagtatatagcacctgagata
attcagtccaagggtcataataaagccgtagattggtgggcattgggagttctcatctac
gaaatgctcgtgggatacccaccattctacgatgaacagccctttgggatctacgagaaa
atattgagcggtaaaattgagtgggagcgacatatggatcccattgccaaagacttgatc
aaaaagctgctggtgaatgatagaaccaaacgactgggcaacatgaagaatggcgccgat
gacgtgaagaggcatcgctggttcaagcacttgaattggaatgacgtctacagcaagaaa
cttaagccaccaattttgcccgatgtacatcacgatggggataccaaaaattttgatgat
tatcccgaaaaggattggaagcccgccaaggcagtagaccaaagagatttgcagtacttc
aatgatttctaa

DBGET integrated database retrieval system