KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6121Help
Entry
Dmel_CG6121       CDS       T00030                                 

Gene name
Tip60
Definition
CG6121 gene product from transcript CG6121-RA (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG6121 (Tip60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:4A6-4B1
AA seq 473 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
SGALAAIPQTPTGASGSVPPPAGIPNSVAPPGTPSSGGELVNGNNLAAALQKRINRKRKN
HGGSAHGHHSLTSQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANDDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITIKYG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaaatatgagttcgacgacgatgtggcctccatatgcgagtcaacg
gccgccctaaccgagggatgtcgtttacccgtcaggatgcacaaaacggacgactggcca
ctagcggagattgtgagcatcaaggagttggatgggcgccggcagttttacgtgcactat
gtggacttcaacaagcgcttggacgagtgggtcaacgaggaggatctgtacacgcgaaag
gtgcaatttccgcggagagacggctcacaaacaggcaccagcactggagtgaccacgcca
cagcgccaccattccctagcgggcagcgtttctcggcctacatcaccgcaacaccctggt
tccggggctctggcagccatcccccagactcctactggtgcatcaggcagtgttcctccc
cctgctggcattccaaactctgtggctccacccggaacaccaagcagtgggggagagctt
gtgaatggcaacaatctggccgcagcccttcagaaacgcatcaatcgcaagcgaaaaaac
cacggaggctcggcccatggacaccacagtctgaccagtcaacagcagcagtcacatccg
catcctacaactccgcagacacccacggctacgcccgtgcatgtgaccggcgacggttta
ataagcggagcggccaatgatgatggtgatggatcgcaggatggcaagacgcccacgccg
aggcaatcaggcagcatggttacgcaccaggacgacgtggtcacccgcatgaagaacgtg
gagatgatcgagctgggcaggcatcgcattaagccctggtatttctcaccctatccgcaa
gagctgtgtcaaatgccctgcatctacatctgcgagttctgcctgaagtacaggaagagc
aggaagtgcctggagaggcacctgtccaagtgcaatcttaggcatccaccgggaaacgag
atctatcgcaaacatacaatttccttctttgaaatcgatggacgcaaaaacaaggtgtat
gcccagaacttgtgcctgcttgccaaactctttctcgaccacaagacactctactatgat
accgatccgtttctcttctacgtaatgacagagttcgactcgcgcggcttccacatagta
gggtacttctccaaggagaaggagagcacagaggactacaacgtggcctgcattctcaca
atgcctccgtatcagcgcaagggctacggcaagctgctcattgagttcagctacgagttg
tccaagttcgagggcaagacgggatcgccggagaaaccattgtctgatctgggtttgctg
tcctatcgatcgtactgggcgcaaaccatactggagatctttatcagccaaaacccgagc
acggacggcgaaaagcccactataactataaagtatggctag

DBGET integrated database retrieval system