KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6122Help
Entry
Dmel_CG6122       CDS       T00030                                 

Gene name
piwi
Definition
CG6122 gene product from transcript CG6122-RA
Orthology
K02156  
aubergine
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG6122 (piwi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:32C1-32C1
AA seq 843 aa AA seqDB search
MADDQGRGRRRPLNEDDSSTSRGSGDGPRVKVFRGSSSGDPRADPRIEASRERRALEEAP
RREGGPTERKPWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVE
FEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISI
KFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIEIREFKMELWPGYETS
IRQHEKDILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTY
RINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL
VVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLR
DWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAV
IAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLIL
CLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWM
IELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWP
MIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQ
LAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLY
SSMGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGTNLHSIPQNALEKKF
YYL
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgatcagggacgtggacgcaggcgtccacttaacgaagatgattcctctact
tcccgaggtagtggtgatgggccgcgggtgaaagtattcagaggatcttcatcaggtgac
ccgagagcggatcctcgtatagaggcttcaagagagagaagagctctcgaggaagctccc
aggcgtgaaggtggcccgacagagcgaaagccgtggggtgaccaatatgattacctgaat
acccgtccggctgagctggtatccaagaagggaaccgatggcgtcccggtcatgctgcag
acgaactttttccgattaaaaaccaagccggaatggcggatcgttcattatcacgtggag
tttgagccgagcatcgagaatcctcgtgtccgtatgggagttttgtccaatcatgctaac
cttctgggatcaggctatctattcgatggactgcaactgttcaccaccaggaaattcgag
caggaaatcacggtgctcagcggaaagtcgaagctggacattgaatacaagatatccata
aagttcgttggattcatatcgtgtgctgagccccgctttttgcaagtcttaaatctaata
ttgcgccgctccatgaagggcctaaatttggaattagttggccgtaatctctttgatccc
cgagctaagatcgaaataagggagttcaaaatggagctatggccgggctatgagacatcg
attcgtcagcacgaaaaagatattttattgggcaccgaaataactcacaaagttatgcgc
accgagacgatctacgacataatgcgacgttgctcacacaatccggctcgtcatcaggac
gaagtacgggtaaatgttttggacttgattgtccttacggattacaataacagaacttat
cgtatcaatgatgtcgactttggacaaactccgaaatcaacattcagttgcaagggtaga
gatatcagtttcgtggaatactatctcactaaatataatatacgcattcgcgaccacaat
cagccgctgctgatctccaaaaatagggacaaggctctaaaaactaacgctagcgaatta
gtggtactaattcctgagctctgccgagtgactgggctcaatgccgagatgcgctcaaac
tttcagcttatgcgtgccatgagcagttatacgcgaatgaaccccaaacaacgcactgat
cgattgcgcgcttttaaccaccgtttacaaaacactccagaaagtgtgaaggtcttgaga
gactggaacatggaactggacaagaacgtcacagaagtacaaggccggataattggacag
cagaacatcgtgtttcataatggaaaggttcctgctggagaaaacgctgattggcaaagg
cacttcagagaccaaaggatgcttaccactccgagcgatggcctcgatcgttgggctgtc
atcgcgccgcaaaggaattcccatgaactccgaactctacttgactctttgtatagagca
gctagtggaatgggtcttagaattcgaagcccccaggaattcataatttatgatgatcgc
actggaacttatgtgagagcaatggatgattgtgtgcgctcagatcccaaacttatatta
tgcctcgtacccaatgataacgccgaaagatactcatcaatcaaaaagagaggatacgtt
gacagggcggtgccaactcaagttgtgacccttaaaacgaccaagaaccgtagccttatg
agcattgccaccaaaatagcaatccaactgaattgcaagttgggatatacaccctggatg
atcgaactacccttgtccggactgatgacaattggctttgacattgcgaagagcacacga
gatcggaagagggcctacggagcattgattgcctcaatggatctacagcaaaactccacg
tacttcagcacagtcacggagtgcagcgcctttgatgtgctcgctaacaccctttggccg
atgatagcaaaggccctgcgccaatatcaacatgagcataggaagctgccatctcgaatc
gtattttatcgagacggtgtgagctccggctctctaaagcagctttttgaatttgaagtc
aaggacatcattgagaagttgaaaactgaatacgcccgcgtccagctaagcccaccgcaa
ttagcttatattgtggtaaccagatccatgaacacgcgcttcttcctcaacggacaaaat
cctccgcctggtactatagttgatgacgttataactctgcccgagagatacgacttttat
ctggtctcgcaacaagttcgtcagggtacagtgtcgccgaccagctacaatgttctttat
agcagcatgggtctctcaccggagaaaatgcaaaaacttacgtacaagatgtgccacttg
tactacaattggtcgggcaccacacgagtgccagcagtttgccagtacgctaagaagcta
gctaccctcgtgggtacgaacttgcactctattccgcaaaacgcgctcgaaaagaagttt
tattatctataa

DBGET integrated database retrieval system