KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6137Help
Entry
Dmel_CG6137       CDS       T00030                                 

Gene name
aub
Definition
(RefSeq) aubergine
  KO
K02156  
aubergine
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG6137 (aub)
Chromosome [BR:dme03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    Dmel_CG6137 (aub)
   piRNA pathway
    Dmel_CG6137 (aub)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:32C1-32C1; 2L:2-39 cM
AA seq 866 aa AA seqDB search
MNLPPNPVIARGRGRGRKPNNVEANRGFAPSLGQKSDPSHSEGNQASGGNGGGGDAQVGP
SIEKSSLSAVQMHKSEGDPRGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKV
LKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPY
VLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYYDPQA
KINLENFRMQLWPGYQTSIRQHENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTF
KRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQP
LVMSRPTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERL
RMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNE
FRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGT
YSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTG
LMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKES
FRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNS
EVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERY
DFFLVSQAVRIGTVSPTSYNVISDNMGLNADKLQMLSYKMTHMYYNYSGTIRVPAVCHYA
HKLAFLVAESINRAPSAGLQNQLYFL
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccaccaaaccctgtaattgctcgtggacgtggtcgaggaagaaagcccaat
aatgtagaggccaatcgcggcttcgctccttcgctgggtcagaagtcggacccttcccac
tcggaaggaaatcaagcatccggaggcaatggtggtggtggtgatgctcaagtgggtccc
tcgatagagaaatccagtttgagcgcggtgcaaatgcacaagtccgagggcgatccgcgt
ggctccgtgcgcggccgtaggctaataacggatttggtgtattcacgtcctccagggatg
accagcaagaaaggagtggttggcactcatattaccgtgcaggcaaactattttaaggta
ttaaagcgtccaaactggaccatctaccagtaccgcgtcgattttacgcctgatgtggag
gctacacgactgcgacggtctttcttgtatgaacataaagggatcctgggcggctacatc
tttgacggaaccaatatgttttgcatcaatcagttcaaagctgttcaagatagcccctat
gttttggaactggttacgaagagtcgtgctggcgaaaacattgaaattaagatcaaggct
gttggatctgtgcaatctacggatgccgagcagtttcaggtccttaatctcatactgcgc
agggccatggagggcttagacttgaagctggtctcgcgctactactacgatcctcaagct
aagattaatttggagaatttccgcatgcaattatggcctggctatcagacttcgattcgc
cagcacgaaaatgatatattactttgttccgagatatgccacaaggttatgcgaactgag
accttgtacaatattttgtccgatgctattcgcgacagtgacgattatcaaagtacattt
aagcgtgcagtaatgggtatggtaatactaacggattataataacaaaacctatcgcatt
gacgatgtcgactttcaatcgacgccattgtgcaaatttaaaaccaatgacggtgagatt
tcgtacgtggattactataagaagcgatacaacataatcattcgcgacttgaagcaacct
ctggtcatgtctcgtccgacagacaaaaatattcgtggtggaaatgaccaggccataatg
atcattcccgagctggcacgggctacgggaatgacggacgctatgcgcgctgactttagg
acgttgagggccatgagtgaacataccaggctgaatccagatcgtcgcatcgaacgcctt
cgcatgttcaacaagcgcttaaagtcgtgtaaacagagtgtagagacccttaagtcctgg
aacatcgagctggactccgccttggtggagattccagcacgcgtgttgccaccggaaaaa
atattattcggcaaccaaaaaatattcgtatgcgacgctcgcgccgattggaccaatgag
tttcgcacctgttcgatgtttaaaaacgtgcatatcaataggtggtatgtgatcacaccg
agtcgaaatctgcgcgagacccaggaatttgtgcagatgtgcatccgcacagccagcagc
atgaagatgaacatctgcaatccaatatatgaggaaattccggatgaccgcaacggcact
tactcccaagcgatcgacaacgccgcagctaacgatccacagatcgtgatggttgtcatg
agatctccaaatgaagagaaatatagctgcattaaaaaacgcacgtgcgtggacagaccg
gtgccatcgcaggtggtgacactaaaagttatcgcgcctcgacagcaaaaaccaactggg
ctgatgtcgatcgccacaaaggtggttattcaaatgaacgccaaattgatgggagctccc
tggcaggtagtgatccccctccacggtctgatgactgttggtttcgatgtctgccattca
ccgaagaataagaacaagtcatatggggctttcgttgcaaccatggaccagaaggagtct
ttccgctacttctccaccgtaaacgaacacattaagggccaagagttgtccgagcagatg
tcggtgaacatggcgtgcgccctgaggtcgtatcaggagcaacaccgttctttgccagag
cgcattctcttctttcgcgacggtgttggcgatggtcagctctaccaggtggtaaacagc
gaggtgaacaccctaaaggacaggctcgacgaaatttacaaatcagctggcaaacaggag
ggctgtcgcatgacatttataattgtatccaagcgcattaattctcgctactttactggg
catcgcaacccagttccgggcactgtagtcgatgacgttattaccttgccagagcgctac
gacttcttcctagtgtcccaggctgttcggataggaactgtgtcgcctaccagctacaat
gttatttctgacaacatgggactaaacgccgataagctgcagatgctctcctataagatg
acccatatgtactacaattacagcggaaccatacgagtccccgctgtctgccattacgcc
cacaaattggctttcctcgtagccgaatccattaatcgtgcgccttcagcaggactgcag
aatcaattgtactttttgtaa

DBGET integrated database retrieval system