KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6137Help
Entry
Dmel_CG6137       CDS       T00030                                 

Gene name
aub
Definition
aubergine
Orthology
K02156  
aubergine
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Class
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dme04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:32C1-32C1; 2L:2-39 cM
AA seq 795 aa AA seqDB search
MHKSEGDPRGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQY
RVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKAVQDSPYVLELVTKSRAG
ENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYYDPQAKINLENFRMQL
WPGYQTSIRQHENDILLCSEICHKVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILT
DYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNI
RGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCK
QSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWTNEFRTCSMFKNVH
INRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAAN
DPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQ
MNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHI
KGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDE
IYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRI
GTVSPTSYNVISDNMGLNADKLQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAESI
NRAPSAGLQNQLYFL
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtccgagggcgatccgcgtggctccgtgcgcggccgtaggctaataacggat
ttggtgtattcacgtcctccagggatgaccagcaagaaaggagtggttggcactcatatt
accgtgcaggcaaactattttaaggtattaaagcgtccaaactggaccatctaccagtac
cgcgtcgattttacgcctgatgtggaggctacacgactgcgacggtctttcttgtatgaa
cataaagggatcctgggcggctacatctttgacggaaccaatatgttttgcatcaatcag
ttcaaagctgttcaagatagcccctatgttttggaactggttacgaagagtcgtgctggc
gaaaacattgaaattaagatcaaggctgttggatctgtgcaatctacggatgccgagcag
tttcaggtccttaatctcatactgcgcagggccatggagggcttagacttgaagctggtc
tcgcgctactactacgatcctcaagctaagattaatttggagaatttccgcatgcaatta
tggcctggctatcagacttcgattcgccagcacgaaaatgatatattactttgttccgag
atatgccacaaggttatgcgaactgagaccttgtacaatattttgtccgatgctattcgc
gacagtgacgattatcaaagtacatttaagcgtgcagtaatgggtatggtaatactaacg
gattataataacaaaacctatcgcattgacgatgtcgactttcaatcgacgccattgtgc
aaatttaaaaccaatgacggtgagatttcgtacgtggattactataagaagcgatacaac
ataatcattcgcgacttgaagcaacctctggtcatgtctcgtccgacagacaaaaatatt
cgtggtggaaatgaccaggccataatgatcattcccgagctggcacgggctacgggaatg
acggacgctatgcgcgctgactttaggacgttgagggccatgagtgaacataccaggctg
aatccagatcgtcgcatcgaacgccttcgcatgttcaacaagcgcttaaagtcgtgtaaa
cagagtgtagagacccttaagtcctggaacatcgagctggactccgccttggtggagatt
ccagcacgcgtgttgccaccggaaaaaatattattcggcaaccaaaaaatattcgtatgc
gacgctcgcgccgattggaccaatgagtttcgcacctgttcgatgtttaaaaacgtgcat
atcaataggtggtatgtgatcacaccgagtcgaaatctgcgcgagacccaggaatttgtg
cagatgtgcatccgcacagccagcagcatgaagatgaacatctgcaatccaatatatgag
gaaattccggatgaccgcaacggcacttactcccaagcgatcgacaacgccgcagctaac
gatccacagatcgtgatggttgtcatgagatctccaaatgaagagaaatatagctgcatt
aaaaaacgcacgtgcgtggacagaccggtgccatcgcaggtggtgacactaaaagttatc
gcgcctcgacagcaaaaaccaactgggctgatgtcgatcgccacaaaggtggttattcaa
atgaacgccaaattgatgggagctccctggcaggtagtgatccccctccacggtctgatg
actgttggtttcgatgtctgccattcaccgaagaataagaacaagtcatatggggctttc
gttgcaaccatggaccagaaggagtctttccgctacttctccaccgtaaacgaacacatt
aagggccaagagttgtccgagcagatgtcggtgaacatggcgtgcgccctgaggtcgtat
caggagcaacaccgttctttgccagagcgcattctcttctttcgcgacggtgttggcgat
ggtcagctctaccaggtggtaaacagcgaggtgaacaccctaaaggacaggctcgacgaa
atttacaaatcagctggcaaacaggagggctgtcgcatgacatttataattgtatccaag
cgcattaattctcgctactttactgggcatcgcaacccagttccgggcactgtagtcgat
gacgttattaccttgccagagcgctacgacttcttcctagtgtcccaggctgttcggata
ggaactgtgtcgcctaccagctacaatgttatttctgacaacatgggactaaacgccgat
aagctgcagatgctctcctataagatgacccatatgtactacaattacagcggaaccata
cgagtccccgctgtctgccattacgcccacaaattggctttcctcgtagccgaatccatt
aatcgtgcgccttcagcaggactgcagaatcaattgtactttttgtaa

DBGET integrated database retrieval system