KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6170Help
Entry
Dmel_CG6170       CDS       T00030                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6, isoform D
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmel_CG6170 (HDAC6)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG6170 (HDAC6)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dmel_CG6170 (HDAC6)
Membrane trafficking [BR:dme04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dmel_CG6170 (HDAC6)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dmel_CG6170 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 32461
NCBI-ProteinID: NP_001162760
FlyBase: FBgn0026428
UniProt: Q9XYX1
Position
X
AA seq 883 aa AA seqDB search
MLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRV
LERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSI
YIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALA
TQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHA
IGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEG
EMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETV
PLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMD
RYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPE
QPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDA
AGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCI
FNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKG
PDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDA
AIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPV
PTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDF
LTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKH
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaatcagggctgcggatcgcaggagagcgtcacggatatattccagaatgct
gtcaacagcaagagtctggtgcggaaaccaacggcactgatctacgatgagtccatgagc
cagcactgttgcctgtgggacaaggagcactacgagtgtcccgagcgcttcacacgagtc
ctggaacgctgtcgcgaactaaatctgacggagcgctgcctggagttgccctcgagatcg
gcgaccaaggatgaaattctgcgcctgcacacagaggagcacttcgagcggctgaaggag
acgtccgggattcgcgatgacgagcgcatggaggagctgagctcccgctacgattcaatt
tacattcatccgtccacattcgagctctccctgctggccagcggctccaccatcgaattg
gtggaccatctggtcgccggaaaggcgcagaatggcatggccatcatccggccaccgggt
caccatgcgatgaaggccgagtacaacggttattgcttcttcaacaacgtggcactggcc
acccagcacgccctcgatgttcacaagctgcagcgcatcctgatcatcgactacgatgtg
catcatgggcagggaacccagcggttcttctacaacgatcccagggtggtttacttctcc
atccatcgcttcgagcacggaagcttctggccgcatctgcacgagtcggattaccacgcc
attggatcgggagcgggcacgggatacaacttcaatgtgccgttgaatgcgacgggtatg
accaatggcgattacctggccattttccagcagctgctgctgccggtggccctggaattc
cagccggagctgatcatcgtttcggctggctatgatgcggcgctgggctgtccggagggt
gagatggaggtgacgccggcctgctatccgcacctgctgaatccgctgctgcgactggcc
gatgcccgggtggccgtcgttctggagggcggctactgcctggactcgctggccgagggt
gcggccctaaccctgcgctccctgctcggcgatccttgtccgccgctggtggagacagtg
ccactgccgcgtgcggaactcgcccaggccctgctcagctgcattgccgtgcaccgaccc
cactggcgatgtctgcagctccagcagacctacgattgcgtcgaattgcaggatcgggat
aaggaagaggatctgcacacggtactgcgccattggattggtggaccaccgcctatggat
cgttaccctacgcgcgatacggccattccgctgccgccggaaaagctgaccagcaatgcc
gctcgtctgcaggtgctgcgcgcggagacgaagctatcggtgccgtcgtttaaggtgtgt
tatgcctacgatgcccaaatgcttctgcactgcaatctcaatgatacggggcatccggag
cagccgtcgcgcatccagcacatccacaagatgcacgacgactacggtctgctgaagcag
atgaagcaactgtcccccagggcggccaccacagacgaggtgtgcctggcccacactcgc
gcccatgtgaatacagtgcgtcgattgctgggccgcgagccgaaggaactgcatgacgct
gctgggatctacaactcggtgtatctgcatccgcgcaccttcgattgcgccaccctggcc
gccggtttagtgctgcaggcggtggacagtgtgctgcgtggcgagtcccgcagcggcatc
tgcaacgtccgtccgccgggccatcatgccgagcaggatcatccgcacggcttctgcatt
ttcaacaatgtggccattgcggcgcagtatgccattcgggatttcggtctggagcgtgtg
ctgatcgtcgactgggacgtccatcacggcaatgggacgcagcacattttcgagtccaat
cccaaggtgctctacatcagcttacatcgctacgagcacggctccttcttcccgaaggga
cccgatggcaatttcgatgtggtgggcaagggagccggcaggggcttcaatgtgaacata
ccctggaacaagaagggcatgggtgacctggagtacgcactggccttccagcagctgatc
atgcccattgcgtacgagttcaatccgcagctggtgttggtatccgccggattcgatgct
gccatcggcgatcccttgggcggatgcaaggtgacggccgagggctacggcatgctcacc
cactggctgtcggctttggccagcggccggataatcgtttgcctggaaggtggctacaat
gtgaactccatttcgtacgcgatgaccatgtgcaccaagacgctgctgggtgatcccgtg
ccgacgccccagctgggagccacggcgctgcagaagccaccaacggtggccttccagagc
tgtgtggaatcgctgcagcagtgcctgcaggtgcagcgcaaccactggcgctcgctggag
ttcgtcggacggcggctgccgcgggatcccgttgtgggcgagaacaacaacgaggatttt
cttaccgcctccttgcgacacttgaatatctcaaatgacgatgctacggctgcggcgggc
ggactcgccggcgatcgtcccgactgcggcgatgagcggcccagcgggagcaagcccaaa
gtcaagcactag

DBGET integrated database retrieval system