KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6170Help
Entry
Dmel_CG6170       CDS       T00030                                 

Gene name
HDAC6
Definition
CG6170 gene product from transcript CG6170-RA (EC:3.5.1.-)
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmel_CG6170 (HDAC6)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG6170 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:13B6-13B6
AA seq 883 aa AA seqDB search
MLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRV
LERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSI
YIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALA
TQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHA
IGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEG
EMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETV
PLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMD
RYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPE
QPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDA
AGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCI
FNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKG
PDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDA
AIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPV
PTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDF
LTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKH
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaatcagggctgcggatcgcaggagagcgtcacggatatattccagaatgct
gtcaacagcaagagtctggtgcggaaaccaacggcactgatctacgatgagtccatgagc
cagcactgttgcctgtgggacaaggagcactacgagtgtcccgagcgcttcacacgagtc
ctggaacgctgtcgcgaactaaatctgacggagcgctgcctggagttgccctcgagatcg
gcgaccaaggatgaaattctgcgcctgcacacagaggagcacttcgagcggctgaaggag
acgtccgggattcgcgatgacgagcgcatggaggagctgagctcccgctacgattcaatt
tacattcatccgtccacattcgagctctccctgctggccagcggctccaccatcgaattg
gtggaccatctggtcgccggaaaggcgcagaatggcatggccatcatccggccaccgggt
caccatgcgatgaaggccgagtacaacggttattgcttcttcaacaacgtggcactggcc
acccagcacgccctcgatgttcacaagctgcagcgcatcctgatcatcgactacgatgtg
catcatgggcagggaacccagcggttcttctacaacgatcccagggtggtttacttctcc
atccatcgcttcgagcacggaagcttctggccgcatctgcacgagtcggattaccacgcc
attggatcgggagcgggcacgggatacaacttcaatgtgccgttgaatgcgacgggtatg
accaatggcgattacctggccattttccagcagctgctgctgccggtggccctggaattc
cagccggagctgatcatcgtttcggctggctatgatgcggcgctgggctgtccggagggt
gagatggaggtgacgccggcctgctatccgcacctgctgaatccgctgctgcgactggcc
gatgcccgggtggccgtcgttctggagggcggctactgcctggactcgctggccgagggt
gcggccctaaccctgcgctccctgctcggcgatccttgtccgccgctggtggagacagtg
ccactgccgcgtgcggaactcgcccaggccctgctcagctgcattgccgtgcaccgaccc
cactggcgatgtctgcagctccagcagacctacgattgcgtcgaattgcaggatcgggat
aaggaagaggatctgcacacggtactgcgccattggattggtggaccaccgcctatggat
cgttaccctacgcgcgatacggccattccgctgccgccggaaaagctgaccagcaatgcc
gctcgtctgcaggtgctgcgcgcggagacgaagctatcggtgccgtcgtttaaggtgtgt
tatgcctacgatgcccaaatgcttctgcactgcaatctcaatgatacggggcatccggag
cagccgtcgcgcatccagcacatccacaagatgcacgacgactacggtctgctgaagcag
atgaagcaactgtcccccagggcggccaccacagacgaggtgtgcctggcccacactcgc
gcccatgtgaatacagtgcgtcgattgctgggccgcgagccgaaggaactgcatgacgct
gctgggatctacaactcggtgtatctgcatccgcgcaccttcgattgcgccaccctggcc
gccggtttagtgctgcaggcggtggacagtgtgctgcgtggcgagtcccgcagcggcatc
tgcaacgtccgtccgccgggccatcatgccgagcaggatcatccgcacggcttctgcatt
ttcaacaatgtggccattgcggcgcagtatgccattcgggatttcggtctggagcgtgtg
ctgatcgtcgactgggacgtccatcacggcaatgggacgcagcacattttcgagtccaat
cccaaggtgctctacatcagcttacatcgctacgagcacggctccttcttcccgaaggga
cccgatggcaatttcgatgtggtgggcaagggagccggcaggggcttcaatgtgaacata
ccctggaacaagaagggcatgggtgacctggagtacgcactggccttccagcagctgatc
atgcccattgcgtacgagttcaatccgcagctggtgttggtatccgccggattcgatgct
gccatcggcgatcccttgggcggatgcaaggtgacggccgagggctacggcatgctcacc
cactggctgtcggctttggccagcggccggataatcgtttgcctggaaggtggctacaat
gtgaactccatttcgtacgcgatgaccatgtgcaccaagacgctgctgggtgatcccgtg
ccgacgccccagctgggagccacggcgctgcagaagccaccaacggtggccttccagagc
tgtgtggaatcgctgcagcagtgcctgcaggtgcagcgcaaccactggcgctcgctggag
ttcgtcggacggcggctgccgcgggatcccgttgtgggcgagaacaacaacgaggatttt
cttaccgcctccttgcgacacttgaatatctcaaatgacgatgctacggctgcggcgggc
ggactcgccggcgatcgtcccgactgcggcgatgagcggcccagcgggagcaagcccaaa
gtcaagcactag

DBGET integrated database retrieval system