KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6284Help
Entry
Dmel_CG6284       CDS       T00030                                 

Gene name
Sirt6
Definition
CG6284 gene product from transcript CG6284-RB
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dmel_CG6284 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86A3-86A3
AA seq 325 aa AA seqDB search
MSCNYADGLSAYDNKGILGAPESFDSDEVVAEKCQELAELIKKSGHVVLHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHL
KSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGRSCRSG
ILYDNVLDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVIC
NLQPTKHDKKANLIISSYVDVVLSKVCKLLGVEIPEYSEASDPTKQSKPMEWTIPTSNVN
TFHRQYKKYVKDSKIESKAKKTKYT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaactacgcggatggattgtcagcctacgacaacaagggaattttgggagca
ccagagagtttcgacagcgatgaggttgtggccgaaaagtgccaggaattggctgaattg
atcaagaaatcgggacacgttgtcctccacacgggagctgggatcagtacgtctgcagga
attccggatttccgcggacccaagggcgtttggaccctggaggagaagggcgagaagccg
gacttcaatgtttccttcgatgaagccagaccaactaaaacccacatggctatcatagcc
ctgattgaaagtggctatgtgcagtacgtaatctcacagaatattgatggtctccacttg
aaatccggactggatcggaagtatctttccgaattgcacggcaacatttacatcgaacag
tgtaagaaatgcagacggcaatttgtgagcccatctgccgtggaaacagtgggtcaaaaa
tccctgcaacgtgcctgcaagtcttcaatggatagcaaaggtcgtagctgtagatcggga
atcctatacgataacgttctggactgggagcacgatcttcccgaaaacgacctcgaaatg
ggtgtgatgcactccaccgtcgctgacctaaatattgcgcttggaaccactttgcagatc
gttcccagcggagaccttcctttaaagaatctaaaatgcggtggaaaatttgtcatttgt
aatctgcagcccacaaaacatgacaaaaaggctaacttaatcatatccagttatgtggat
gtggttttgtccaaagtttgtaaactattgggtgttgagatacccgaatattcggaggct
tccgatcctacaaagcagtccaagccaatggagtggacaatacccacaagcaatgtaaat
acctttcacagacaatataaaaagtatgtaaaagactcaaaaattgaatctaaagctaag
aaaacaaagtacacgtaa

DBGET integrated database retrieval system