KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6415Help
Entry
Dmel_CG6415       CDS       T00030                                 

Definition
CG6415 gene product from transcript CG6415-RA (EC:2.1.2.10)
Orthology
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycine, serine and threonine metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dme01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dme00260]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dme00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:32A4-32A4
AA seq 405 aa AA seqDB search
MFRLSYRLPAALGGLRHASSAAGEGQRTALYDFHVQKGGKIVNFGGYALPVQYSDQSIIA
SHLHTRQVGSIFDVSHMLQSRIFGKDAAACLESVCTADILGTPEGSGSLTVFTNEAGGIL
DDLIVNKVSEKELYVVSNAAMKEQDMGIMKTAVDNFKSQGKDVSIEFLTPADQSLVAVQG
PQVAKELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGVEISVASSQAQK
LTESLLESGVLKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDF
PGADVILGQLKEGVSRRRVGLQMLGTKPPPARSGVAIFSQGQQVGQVTSGCPSPSAGRNI
AMGYVAENLKAPGTKVEFKVRDKLYEAEVTKMPFVKANYYNRPKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttcagactaagctatcgactgcccgctgccctcggcggtctgcgccacgcctcctcc
gccgccggcgagggtcagcgcaccgccctctacgatttccacgtgcagaaaggcggaaag
atcgtgaacttcggaggctatgctctgccggttcagtattcggatcagagcattatagcc
tcccacctgcacacccgtcaggtgggctccattttcgacgtgtcgcacatgctgcaatcc
cggattttcggcaaggatgcggccgcctgtctggagtcggtttgcactgcggacattctg
ggcacgccggagggcagtggtagcctcaccgtcttcaccaacgaggcgggcggtatcctg
gacgatctcatcgtgaacaaagtcagcgaaaaggagctatatgtggtctccaatgcggcg
atgaaagaacaggacatgggcataatgaagacagctgtggataattttaagtcccaggga
aaagacgtatccattgaattcctcacacccgccgatcaatctctagtagccgtccagggt
cctcaagtggccaaggaactatcgaaactacttaccgggaaagcttctctcgatcaactc
tacttcatgagttccttcgtcaccacattggctggaatccccaatgtcaggatcacgaga
tgtggttacaccggtgaggacggtgtggagatatcggtggcatccagccaggcacagaag
ctcactgaatctcttcttgagagtggagtcctcaagcttgctggtctgggagccagagac
tccctgcgattggaggcgggtctctgcttgtatggcagtgatatcgattctaagacgaca
cccgtggaggcggctcttgcctggttggtaaccaaaagacgccgcacaacccgcgatttt
ccaggagctgacgtgatccttggccagctgaaggagggcgtcagccggaggcgagtgggt
ctccagatgttgggcaccaagccaccgccagctcgttccggagtggccatctttagtcag
ggtcagcaggtgggtcaggtgactagtggctgcccaagtcccagtgctggacgcaacatt
gctatgggatatgtggcagagaatctaaaagcacccggcacaaaggtggagttcaaggtt
cgagacaagctctacgaggctgaagtcactaaaatgccatttgtaaaagctaactattat
aacagaccaaagaaataa

DBGET integrated database retrieval system