KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6428Help
Entry
Dmel_CG6428       CDS       T00030                                 

Definition
CG6428 gene product from transcript CG6428-RA (EC:3.1.1.5 3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:4A1-4A1
AA seq 631 aa AA seqDB search
MDIPVLKTNGHERLASLDKSMPPASPTLPSPTIRRNKSDGKLMAQDVKEARVKVIYTGGT
IGMVRNERNVLAPIPNALVRSIRKYPNIHDEEYALRRFGASASMAPLVLPIVQGVDRRVI
YQISEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFVVLHGTDTLSYTASALSFMLENL
GKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPEVCIFFGHKLMRGNRTVKVSSNA
LDAFDSPNVPPLARIGIDVNVDYRLIFRPCTIERFCVHLNLDENVGLLRIFPSISHSTFR
AFLAPPIRGVVLQSFGSGNIPSNRKDLIDELRAAGERGVIIINCTQCPNGTVAEIYDTGK
VLCDVGVIPGFDMTPEAALAKLAYVIGKEEWSLDMKKQMMQSSLRGELTSLKAPKMEDYD
LVDAVARSLHLSSPQELDQLGETLFPAMINAAVAEGDPKKINNLKAYGADLSGTNHDQRT
ALHLACQLGNVEIVKYLLQNGVSVHVRDRYDRTPLLEAVATDSHEIIQLLINCGAHLTGS
SRAVGEQLCAAAARGSMIRLKSYQYAGADLAQSDPSGRTALHVAALHGFPEVVQYVLPYF
ENPNEKDMLGLTAMDYAERGGHAAVMEVLKS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggatattcccgtcctgaagaccaatggtcacgagaggctggcctcgctggacaaaagc
atgccgccggcatcgcccactctgccgagtcccacgatccgcaggaataaaagtgatgga
aaactcatggcccaggatgtcaaagaggcccgggtgaaggtcatctacactggcggcacc
atcggcatggtgcgcaacgagcggaatgtgttagctcccattcccaatgccctggtgcgc
agcatccgcaaatatccaaacatccacgatgaggagtacgcgctgcgccgctttggagca
tctgcatcgatggctccactggtgctgcccattgtgcagggcgtagatcgccgggttatc
taccagatctcggaatatacaccgctgctggacagcagcaatatgacgatgaacgattgg
gcgcgaatcgccagcgatattcagcaatcgtacgagttcttcgatggctttgtggtgctc
catggcaccgacacgctttcctacaccgcatctgcattgtctttcatgttggaaaatttg
ggcaagacggtgatcatcacgggctcccaaatacccatctttgagacgcgaaccgatggc
aaggacaattttacgtcagccttgatcatagccggtaactacatcattccggaggtttgc
atcttctttggccataagttgatgcgcggcaatcggacggtgaaggtcagttcgaatgcc
ttagacgcgttcgactcaccgaatgttccaccactggccaggatcggcattgatgtgaac
gtcgactaccgcctgatattccggccatgcactattgaaaggttttgcgtacacttgaat
ctcgacgagaacgtcggcttgctgcgaatctttccgagcatttcgcactccacattccgg
gctttcctggcgccaccgattcgcggcgttgtcctgcaatccttcggatctggaaacata
ccatcgaaccgaaaagatctcatcgatgaactgcgtgcggctggtgaacgaggcgttatc
atcatcaattgtacacagtgtcccaatggcacagtggcggagatctacgatacgggcaag
gtgctctgcgatgtcggtgtaattcccggtttcgatatgacgcccgaggcggcgctggcc
aagctggcctatgtcatcggcaaggaggagtggtcactcgatatgaagaagcagatgatg
cagtcaagcctgaggggcgaactgacctccttaaaggctcccaaaatggaggactacgac
ttggtggacgcagtggcacggtctctgcacttgtcctcgccccaagaactggatcagctg
ggcgaaacgctctttccggccatgatcaacgccgctgtggccgaaggtgatcccaagaag
atcaacaacttgaaagcctatggcgccgacttgtcgggcacaaatcatgaccagcgaacg
gccctacacttggcttgtcagctgggaaacgtggagatcgttaagtacctactgcagaac
ggggtgtccgtgcacgtgcgtgatcggtatgaccgcactccacttctggaggctgtcgcc
accgatagccacgagatcatccagttgctcatcaactgtggtgctcatttgacgggctct
tcgcgagcggtgggcgagcaattgtgcgcggccgctgctaggggatcgatgatcagattg
aagtcctatcaatacgccggtgccgatcttgcccagtcggatccttcgggcaggacggcc
ttgcacgtggcagcactgcacggatttccggaggtggtgcaatacgtcctgccctatttc
gagaatccgaacgagaaggacatgctcggcctgaccgccatggattatgcggagcgcggc
ggacacgcagcggttatggaggtcctaaaatcatag

DBGET integrated database retrieval system