KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6543Help
Entry
Dmel_CG6543       CDS       T00030                                 

Definition
(RefSeq) CG6543, isoform A
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00062  Fatty acid elongation
dme00071  Fatty acid degradation
dme00280  Valine, leucine and isoleucine degradation
dme00310  Lysine degradation
dme00380  Tryptophan metabolism
dme00410  beta-Alanine metabolism
dme00640  Propanoate metabolism
dme00650  Butanoate metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
dme01212  Fatty acid metabolism
Module
dme_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dme_M00085  Fatty acid biosynthesis, elongation, mitochondria
dme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dmel_CG6543
   00650 Butanoate metabolism
    Dmel_CG6543
  Lipid metabolism
   00062 Fatty acid elongation
    Dmel_CG6543
   00071 Fatty acid degradation
    Dmel_CG6543
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG6543
   00310 Lysine degradation
    Dmel_CG6543
   00380 Tryptophan metabolism
    Dmel_CG6543
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dmel_CG6543
Enzymes [BR:dme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dmel_CG6543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 36536
NCBI-ProteinID: NP_610910
FlyBase: FBgn0033879
UniProt: Q7JR58
Position
2R
AA seq 295 aa AA seqDB search
MANIAKIFASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRP
KALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGN
FLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGG
TQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNL
IVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggccaacattgctaagatcttcgctagccgcgcccagtgcgtcctgcaggcagccgcc
cgtcagccacaggtggccacccgtttcagcagctcctccaccaacaacaactgggagtac
atcaagaccgaagtggccggcgagggcaagaacgtaggcgtgatcaccctgaaccgcccc
aaggccctgaatgccctctgcaatggcctgatgaaggagctgtccaccgcattgcagcaa
ttcagcaaggataagaccatctccgccatcgttttgacgggcagcgagaaggccttcgcc
gctggcgctgatattaaggagatggtgggcaacacctactcgcagtgcatccagggcaac
ttcttgaacgactggacagaggtggcccgcacccagaagcccatcattgctgccgtgaat
ggttacgccttgggcggtggctgtgagctggccatgatgtgcgacatcatatatgccggt
gacaaggccaagtttggtcagcctgaaattgccctgggcaccattcccggtgccggtggc
acccagcgtctgacccgcgtcgttggcaagtccaaggccatggaaatgtgcctcaccggc
aatatgatcggcgcccaggaggctgagaagctgggtctggccagcaaggtggtgcccgcc
gaccagttattgggcgaggccgtcaagctgggcgagaagatcggcacccactccaatctg
atcgtgcagctgtgcaaggaggcggttaacacggcttacgagaccactctccaagagggc
ctgaagttcgagcgtcgcaccttccatgccacgttctccacggccgatcgcaaggagggc
atgaccgctttcgccgagaagcgccctgccaagtttaccaacgagtaa

DBGET integrated database retrieval system