KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6593Help
Entry
Dmel_CG6593       CDS       T00030                                 

Gene name
Pp1alpha-96A
Definition
Protein phosphatase 1alpha at 96A (EC:3.-.-.-)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dmel_CG6593 (Pp1alpha-96A)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG6593 (Pp1alpha-96A)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dmel_CG6593 (Pp1alpha-96A)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dmel_CG6593 (Pp1alpha-96A)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG6593 (Pp1alpha-96A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:96A5-96A5
AA seq 327 aa AA seqDB search
MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
RFVYPNFGSSGRPLTPPRGANNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcatgaacatcgacagtatcatctcgcgcctgctggaggtgcgcggtgca
cgaccgggaaagaatgttcagctatcagagagcgagatccgcagcctgtgcctcaagtcc
cgcgagatattcctgtcgcagcccatactcctggagctggaggcaccgctgaagatctgc
ggcgacatacacggacaatattatgacctcttgcgcctgttcgaatacggcggctttccg
cccgagtcaaactacctgttcctgggcgactatgtcgatcgcggcaagcaatccctggag
acgatatgcctgctgctggcctacaagatcaagtacgcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcatcaatcgcatctacgggttctatgacgaatgtaaacgt
cgctacaccatcaagctgtggaaaactttcacggactgcttcaactgcctgccggtggcc
gccatcgtggatgagaagatcttctgctgccacggtggcctgagtccagatctgtcgtcc
atggagcagatacgacgcatcatgcgtcccacagacgtgcccgatcagggactgctgtgc
gatctgctgtggtcggatccggataaggataccatgggctggggcgagaatgatcgcggc
gtgagcttcacatttggagcagaggttgtgggtaaatttttacagaagcacgaatttgac
ctgatctgtcgggctcatcaggtagtggaggacggttatgagttcttcgccaaacgtcag
ctggtgacgctcttctcggcgcccaactactgcggggaattcgacaacgcgggtgccatg
atgtccgtggacgacacattgatgtgctccttccagatattgaaacccgccgacaagcga
cgatttgtttatcccaactttggcagctcaggacgtcctttgacaccgccacgcggagct
aacaataaaaacaagaaaaaataa

DBGET integrated database retrieval system