KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6593Help
Entry
Dmel_CG6593       CDS       T00030                                 

Gene name
Pp1alpha-96A
Definition
Protein phosphatase 1alpha at 96A (EC:3.-.-.-)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dme03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:96A5-96A5
AA seq 327 aa AA seqDB search
MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
RFVYPNFGSSGRPLTPPRGANNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcatgaacatcgacagtatcatctcgcgcctgctggaggtgcgcggtgca
cgaccgggaaagaatgttcagctatcagagagcgagatccgcagcctgtgcctcaagtcc
cgcgagatattcctgtcgcagcccatactcctggagctggaggcaccgctgaagatctgc
ggcgacatacacggacaatattatgacctcttgcgcctgttcgaatacggcggctttccg
cccgagtcaaactacctgttcctgggcgactatgtcgatcgcggcaagcaatccctggag
acgatatgcctgctgctggcctacaagatcaagtacgcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcatcaatcgcatctacgggttctatgacgaatgtaaacgt
cgctacaccatcaagctgtggaaaactttcacggactgcttcaactgcctgccggtggcc
gccatcgtggatgagaagatcttctgctgccacggtggcctgagtccagatctgtcgtcc
atggagcagatacgacgcatcatgcgtcccacagacgtgcccgatcagggactgctgtgc
gatctgctgtggtcggatccggataaggataccatgggctggggcgagaatgatcgcggc
gtgagcttcacatttggagcagaggttgtgggtaaatttttacagaagcacgaatttgac
ctgatctgtcgggctcatcaggtagtggaggacggttatgagttcttcgccaaacgtcag
ctggtgacgctcttctcggcgcccaactactgcggggaattcgacaacgcgggtgccatg
atgtccgtggacgacacattgatgtgctccttccagatattgaaacccgccgacaagcga
cgatttgtttatcccaactttggcagctcaggacgtcctttgacaccgccacgcggagct
aacaataaaaacaagaaaaaataa

DBGET integrated database retrieval system