KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6644Help
Entry
Dmel_CG6644       CDS       T00030                                 

Gene name
Ugt35a
Definition
(RefSeq) UDP-glycosyltransferase 35a
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG6644 (Ugt35a)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG6644 (Ugt35a)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG6644 (Ugt35a)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG6644 (Ugt35a)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG6644 (Ugt35a)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG6644 (Ugt35a)
   00983 Drug metabolism - other enzymes
    Dmel_CG6644 (Ugt35a)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG6644 (Ugt35a)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG6644 (Ugt35a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 41334
NCBI-ProteinID: NP_524314
FlyBase: FBgn0026315
UniProt: Q9VGS9
Position
3R
AA seq 537 aa AA seqDB search
MGGIFSVTGLGILLIGLIWLFAANADEGVQSSRILAVFPFPGRSQYIFAEQFMKELAHRG
HNVTVINTFGSDKNEPNFRVIGAKKIHEIMAAFGNADYTQTASQWQMLTMTTQFLNLLTT
SILDDAAVKDLLNSGEKFDLVIMEAVQTEALFGLIQHFGAETIGISSYGTDTHIDELMGN
ISPLSYNPLLLSSRTEQMDFKDRVMNVFEASVMWLHKRIVHLPSQRDLYAKYFPTARKSL
DEVLDSFALMLLGQHFSLSYPRPYLPNMIEVGGLHLQQKRKVQPLAKELSEFVEQSEKGV
IYFSMGSNIKSKDLPPSTRKMLMQTFASVPQRVLWKFEDDQLPEKPDNVFISKWFPQPDI
LAHPNVKLFITHGGLLSTIESIYFGKPILGLPIFYDQHLNVQRAKQVGYGLSADIWSVNA
TELTPLIQELLSNPSYAAAAQTKSKLFRDQKETALERAIWWTEYVLRHKGAKHLRCASRD
LDFIQFHGLDTWGLLIAITFVSLLIVVILIKCLQRVFVSLISKIRKNRAEASKLKTQ
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaatattttctgtaactggtcttggcattctgctaattggcctgatatggctg
ttcgccgcaaatgccgatgaaggggttcaaagttcgcgcatattggccgtgtttcctttt
cccggccgatcgcagtacattttcgctgagcagtttatgaaggaactggcccatcggggt
cacaatgtcaccgtaatcaatacctttggtagcgataaaaacgagcccaactttcgggtg
attggtgctaaaaaaattcacgaaataatggcggcatttggaaatgcagattacacccaa
acggcgagtcaatggcaaatgttgactatgaccacacagtttctcaatcttttgaccaca
agtatcctggatgatgcggctgtaaaggatttactgaacagcggcgagaaattcgatttg
gttataatggaagcggtgcaaaccgaagccctcttcggtttgatccagcattttggagca
gaaaccataggtatctcatcgtacggcacagatacacacatcgatgagttaatgggcaac
atatcgccattgtcctacaatcccttgctactctcatcgcgaacggagcaaatggatttc
aaggatcgtgtgatgaatgtgtttgaagcctcggtaatgtggctgcacaagaggattgtc
cacctgccgtctcaacgggatctgtatgcgaaatactttcccacggccaggaaatcattg
gatgaagttttggacagctttgcgctaatgcttctcggccagcacttttccctgagctat
ccacgcccctatttgcccaatatgatcgaggtgggcggactgcatttacaacagaagcga
aaggttcagcccttagcaaaggaactgtcggaatttgtcgagcaatcggagaagggagta
atctatttctccatgggttccaatatcaaaagcaaagacttgccgccatccacacgaaaa
atgctaatgcaaacctttgccagtgtgccacaacgtgtgctgtggaaattcgaggatgat
cagttgcccgaaaaacccgataatgtcttcatcagcaagtggttcccccaacccgatatt
ctcgctcatccgaatgttaagctcttcatcacccacggaggtctattgagcaccatcgag
agtatatactttggaaagcccatacttggattgcccattttctatgatcagcacttgaat
gttcagagggccaagcaggtaggctatggtctcagtgctgatatatggagtgtcaatgcg
acagaactgacgcctttgatccaggaattgctgagtaatcccagttatgcggcagcagct
cagactaaatccaaattattccgagatcagaaggaaaccgctttggagcgcgccatttgg
tggaccgagtacgtattgcggcataagggagccaaacacttgagatgtgcttcgcgtgat
ctggattttattcagttccacggactggacacctgggggctcctcatcgcaatcactttt
gtctccctactgatcgtcgttattttgattaaatgcttacaaagggtcttcgtttcgctt
ataagtaaaatccgaaaaaatcgtgcggaggcgagtaaattgaagacccagtaa

DBGET integrated database retrieval system