KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6649Help
Entry
Dmel_CG6649       CDS       T00030                                 

Gene name
Ugt35b
Definition
(RefSeq) UDP-glycosyltransferase 35b
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG6649 (Ugt35b)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG6649 (Ugt35b)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG6649 (Ugt35b)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG6649 (Ugt35b)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG6649 (Ugt35b)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG6649 (Ugt35b)
   00983 Drug metabolism - other enzymes
    Dmel_CG6649 (Ugt35b)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG6649 (Ugt35b)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG6649 (Ugt35b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C PIG-Y
Motif
Other DBs
NCBI-GeneID: 41333
NCBI-ProteinID: NP_524313
FlyBase: FBgn0026314
UniProt: Q9VGT0
Position
3R
AA seq 516 aa AA seqDB search
MLALRIGFLLLTLPASMQAARILAIFPFPGPSQYINVVPYLKELANRGHQVTSVNAFPQK
KPVVNFRDVFIPDVFNNYKELINELSGPMNLWQENNFINKFFVSVTRCVLTNKEVTETLL
PPGKDHFDLIIVEALRSDAYYGFAAHFNAPIIGISTFGTDWNIDALVGNESPLSYTPLAT
GGLTDRMTFLERLSNFVDTTVAWLNYRFVHMSEQEKMYAKYFPEASKRVQLTDLNRNFSL
VLLNQHFSLSFPRPYVPNMIEVGGLHISHKPAPLPKDLEEFIQGSGEHGVIYFSLGSNVL
SKDLPADRKDLILKTFASLPQRVLWKFEDDKLPGKPSNVFISKWFPQPDILAHPKVKLFI
THGGLLSTIESIHHGKPVLGLPFFYDQFLNVRRATQAGFGLGLDHTTMTQQELKETIEIL
LKEPRFAQIARQMSERYRDQPMSPLDTAIWWTEYVLRHKGAYHMRVAGQDLGFFAYHSLD
VIGVLLGGALLLVAIIVGVLGKLTDFGNAKKKLKSK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctctacggataggttttttgttactaactctgccagcttctatgcaagctgcc
aggatattggctatatttccgtttccggggccatcacagtatattaatgtggtaccttat
ttaaaggaactggctaatcggggtcaccaggtgacctcggttaatgcgtttccgcaaaag
aaaccagtggttaacttcagagatgtgtttatcccagatgtatttaacaattataaggaa
ttgataaacgaactgagcggaccaatgaatttgtggcaagagaacaacttcatcaataaa
ttctttgtaagcgttacacgctgtgttcttaccaacaaagaggttacagaaacccttttg
ccaccgggaaaggatcatttcgatcttataattgtagaggctctacgctcggatgcctac
tatggattcgcggcccacttcaatgcacctataattggcatatccacctttggaactgat
tggaatattgatgcgctagtgggcaatgaatctcctctatcgtatactccgctagcaacg
gggggtcttacggatcgaatgactttcttggagcgtctgtccaactttgtggatactacg
gttgcctggcttaactacagatttgttcatatgtcagagcaggagaaaatgtatgcgaaa
tactttcccgaggcctcgaaaagggttcaactcaccgatttgaatagaaacttctcgcta
gtattgctgaatcagcacttttcgttgagcttcccgcgtccgtacgttccgaacatgatc
gaggttggaggtctgcacatatcccacaagccggctcctctgcccaaggacttggaagag
tttattcaaggttccggagagcacggtgtgatatacttttcactgggctctaatgttctc
agtaaggatctaccggcagataggaaagatcttatcctaaaaaccttcgccagcttgccg
cagcgagtgctctggaaattcgaggacgacaagttgcctggcaaaccgtccaatgttttt
atcagcaaatggtttcctcagccggatatcctggcccatcccaaggtcaagctctttatc
acccacggcggattgttgagcaccatcgagagcattcatcatggcaaaccggtcttgggt
ctgcccttcttttacgatcaattcctgaatgtaaggcgggccacgcaggcgggttttgga
ttgggactcgatcacacgacaatgacacagcaggaacttaaggagaccatcgagatattg
ctcaaggagccgagatttgcgcagattgctaggcagatgtcggaacgatatcgtgatcag
ccaatgagtccactggacaccgccatttggtggacggaatacgttctgcggcacaaaggt
gcctaccacatgagagtggctggccaggatttgggtttcttcgcctaccacagcctggat
gtcattggagtccttttgggcggagctcttctacttgttgcgatcattgtgggagtcctt
ggcaagcttacggattttggaaatgcaaagaaaaagctaaaatcgaagtaa

DBGET integrated database retrieval system