KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6917Help
Entry
Dmel_CG6917       CDS       T00030                                 

Gene name
Est-6
Definition
Esterase 6 (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:dme00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:69A1-69A1; 3L:3-35.9 cM
AA seq 544 aa AA seqDB search
MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYESIPYAEPPTGD
LRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLVGEEDCLTVSVYKPKNSKRNS
FPVVAHIHGGAFMFGAAWQNGHENVMREGKFILVKISYRLGPLGFVSTGDRDLPGNYGLK
DQRLALKWIKQNIASFGGEPQNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALD
PWVIQKGARGRAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLKERKSGIVIDD
LNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQRFDIESYSELQRLFTDILFKN
STQESLDLHRKYGKSPAYAYVYDNPAEKGIAQVLANRTDYDFGTVHGDDYFLIFENFVRD
VEMRPDEQIISRNFINMLADFASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQH
VEFP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgtgggactgggacttatcattgtgctgagctgcctttggctcggttcgaac
gcgagtgatacagatgaccctctgttggtgcagctgccccagggcaagctacgtggtcgc
gataatggaagctactacagctacgaatcgattccctacgccgaaccgcccactggcgat
ctacgattcgaggctccagagccgtacaaacaaaagtggtcggatatattcgatgccacc
aaaaccccggtggcgtgcctgcagtgggatcagttcacgcctggggccaacaaattggta
ggagaggaggattgcctaaccgtcagcgtctacaagccgaagaatagcaagaggaatagc
tttccggtggtggcccacattcacggaggtgcctttatgttcggtgcagcatggcaaaat
ggacacgagaacgtgatgcgtgagggcaaattcattctggtgaagataagctatcgcctg
gggccattgggtttcgtgagcaccggcgatagggatcttcccggaaactatggactgaaa
gatcaacggctggctctcaaatggattaagcagaatatagccagttttggtggagaaccg
cagaacgtactgttggttggtcactccgctggaggagcttcggtccatctgcagatgctt
cgtgaagatttcggccagctggccagggcggcattctcgtttagtggaaatgctctagat
ccatgggttatacagaagggagcaagaggacgagcctttgaactgggacgcaacgtggga
tgtgaatcggctgaagactcgaccagcctgaagaaatgcctaaagtcaaagccagccagt
gaattagtcaccgccgtccgtaaattccttatattttcctatgtgccctttgctccattt
agtcctgtattggagccatcggatgctccagacgccattatcacccaggatcccagggat
gtcattaagagcggaaagttcggacaggttccgtgggctgtttcctatgtcacagaggat
ggtggctacaatgccgccttgcttttgaaggaacggaaatctggaatagttatcgatgat
ctaaacgagcgttggcttgagttggcaccatatttactattctaccgggacacgaagacc
aaaaaggatatggacgactactcgcggaaaattaagcaggagtatataggcaatcagaga
tttgacatcgaaagctattcagaattgcagcggctattcacggatattctcttcaagaat
agcacgcaggagtcattggatcttcatcgcaaatatggaaagagtcctgcctacgcttat
gtctatgacaatccagccgaaaaaggaatcgcacaggtcctggccaatcgaaccgattat
gattttggaactgtacacggtgacgactactttttgatattcgaaaatttcgtacgagat
gtggaaatgcgtccggatgagcagataatttcgagaaattttatcaatatgctggcagat
tttgcttcgagtgataatggctctctaaaatatggtgaatgcgatttcaaagataatgta
ggtagtgagaaattccaattattagctatttatattgatggctgccagaataggcagcat
gtggaatttccgtaa

DBGET integrated database retrieval system