KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6917Help
Entry
Dmel_CG6917       CDS       T00030                                 

Gene name
Est-6
Definition
(RefSeq) esterase 6, isoform B
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmel_CG6917 (Est-6)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dmel_CG6917 (Est-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 39392
NCBI-ProteinID: NP_001261749
FlyBase: FBgn0000592
UniProt: P08171 C9QP21
Structure
PDB: 

Jmol
Position
3L
AA seq 544 aa AA seqDB search
MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYESIPYAEPPTGD
LRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLVGEEDCLTVSVYKPKNSKRNS
FPVVAHIHGGAFMFGAAWQNGHENVMREGKFILVKISYRLGPLGFVSTGDRDLPGNYGLK
DQRLALKWIKQNIASFGGEPQNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALD
PWVIQKGARGRAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLKERKSGIVIDD
LNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQRFDIESYSELQRLFTDILFKN
STQESLDLHRKYGKSPAYAYVYDNPAEKGIAQVLANRTDYDFGTVHGDDYFLIFENFVRD
VEMRPDEQIISRNFINMLADFASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQH
VEFP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgtgggactgggacttatcattgtgctgagctgcctttggctcggttcgaac
gcgagtgatacagatgaccctctgttggtgcagctgccccagggcaagctacgtggtcgc
gataatggaagctactacagctacgaatcgattccctacgccgaaccgcccactggcgat
ctacgattcgaggctccagagccgtacaaacaaaagtggtcggatatattcgatgccacc
aaaaccccggtggcgtgcctgcagtgggatcagttcacgcctggggccaacaaattggta
ggagaggaggattgcctaaccgtcagcgtctacaagccgaagaatagcaagaggaatagc
tttccggtggtggcccacattcacggaggtgcctttatgttcggtgcagcatggcaaaat
ggacacgagaacgtgatgcgtgagggcaaattcattctggtgaagataagctatcgcctg
gggccattgggtttcgtgagcaccggcgatagggatcttcccggaaactatggactgaaa
gatcaacggctggctctcaaatggattaagcagaatatagccagttttggtggagaaccg
cagaacgtactgttggttggtcactccgctggaggagcttcggtccatctgcagatgctt
cgtgaagatttcggccagctggccagggcggcattctcgtttagtggaaatgctctagat
ccatgggttatacagaagggagcaagaggacgagcctttgaactgggacgcaacgtggga
tgtgaatcggctgaagactcgaccagcctgaagaaatgcctaaagtcaaagccagccagt
gaattagtcaccgccgtccgtaaattccttatattttcctatgtgccctttgctccattt
agtcctgtattggagccatcggatgctccagacgccattatcacccaggatcccagggat
gtcattaagagcggaaagttcggacaggttccgtgggctgtttcctatgtcacagaggat
ggtggctacaatgccgccttgcttttgaaggaacggaaatctggaatagttatcgatgat
ctaaacgagcgttggcttgagttggcaccatatttactattctaccgggacacgaagacc
aaaaaggatatggacgactactcgcggaaaattaagcaggagtatataggcaatcagaga
tttgacatcgaaagctattcagaattgcagcggctattcacggatattctcttcaagaat
agcacgcaggagtcattggatcttcatcgcaaatatggaaagagtcctgcctacgcttat
gtctatgacaatccagccgaaaaaggaatcgcacaggtcctggccaatcgaaccgattat
gattttggaactgtacacggtgacgactactttttgatattcgaaaatttcgtacgagat
gtggaaatgcgtccggatgagcagataatttcgagaaattttatcaatatgctggcagat
tttgcttcgagtgataatggctctctaaaatatggtgaatgcgatttcaaagataatgta
ggtagtgagaaattccaattattagctatttatattgatggctgccagaataggcagcat
gtggaatttccgtaa

DBGET integrated database retrieval system