KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6988Help
Entry
Dmel_CG6988       CDS       T00030                                 

Gene name
Pdi
Definition
Protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG6988 (Pdi)
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmel_CG6988 (Pdi)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dmel_CG6988 (Pdi)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG6988 (Pdi)
  Exosomal proteins of bladder cancer cells
   Dmel_CG6988 (Pdi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:71B5-71B5
AA seq 496 aa AA seqDB search
MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALD
SFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDF
NHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEP
VEETEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatctgtgcacttttcttggcggcgtcctacgtggccgcttccgccgag
gcggaggtcaaagttgaggagggtgttctggtggcgacggtggacaacttcaagcagctg
attgccgacaacgagttcgtgctggtcgagttctacgccccatggtgcggacactgcaaa
gctctggctcccgagtacgccaaggctgcccagcaactggccgagaaggagtcgcccatc
aagctggccaaggtcgatgccaccgtcgagggtgagctggccgagcagtacgccgtccgt
ggctaccccactctgaagttcttccgcagcggctctccagtggagtacagcggtggccgc
caggccgctgacatcattgcctgggtgaccaagaagaccggcccaccagccaaggatctg
accagcgtcgctgatgccgagcaattccttaaggacaacgagatcgccatcattggattc
ttcaaggacctggaatcggaggaggccaagaccttcaccaaagtcgccaacgccctggac
tcgttcgtctttggtgtgagcagcaatgccgatgtgattgccaagtacgaggctaaggac
aatggagtggttctgttcaagcccttcgacgacaagaagtccgtgttcgagggtgagctg
aacgaggaaaacctgaagaagttcgcccaggtgcagtctctgcccctgatcgttgacttc
aaccacgaatctgcttccaagatcttcggtggctcgatcaagtcgcatctgctgttcttc
gtgtccagggagggcggccacatcgagaagtacgtcgatcccctgaaggagatcgccaag
aagtaccgcgacgacatcctgttcgtgaccatctcgtccgacgaggaggaccatacccgc
atcttcgagttcttcggcatgaacaaggaggaggtgcccaccatccgtctgatcaagctg
gaagaggacatggccaagtacaagcccgaatcggacgatctgtccgccgagaccatcgag
gcgttccttaagaagttcctggacggcaagctgaagcaacacctcctttcccaggagctg
cccgaggattgggacaagaaccccgtcaaggtgctggtatccagcaacttcgagagcgtt
gccctggacaagagcaagagcgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggcccccatctacgaccagctggctgagaagtacaaggacaatgaggatatt
gtcattgccaagatggactccactgccaacgagctggagagcattaagatctcgtccttc
cccacaatcaaatacttccgcaaggaggacaacaaggtcatcgacttcaacctggacagg
actctcgatgatttcgtcaagttcctcgatgccaacggtgaggtggccgattccgagccc
gtcgaggagaccgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system