KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6988Help
Entry
Dmel_CG6988       CDS       T00030                                 

Gene name
Pdi
Definition
Protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dme04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:71B5-71B5
AA seq 496 aa AA seqDB search
MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALD
SFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDF
NHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEP
VEETEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatctgtgcacttttcttggcggcgtcctacgtggccgcttccgccgag
gcggaggtcaaagttgaggagggtgttctggtggcgacggtggacaacttcaagcagctg
attgccgacaacgagttcgtgctggtcgagttctacgccccatggtgcggacactgcaaa
gctctggctcccgagtacgccaaggctgcccagcaactggccgagaaggagtcgcccatc
aagctggccaaggtcgatgccaccgtcgagggtgagctggccgagcagtacgccgtccgt
ggctaccccactctgaagttcttccgcagcggctctccagtggagtacagcggtggccgc
caggccgctgacatcattgcctgggtgaccaagaagaccggcccaccagccaaggatctg
accagcgtcgctgatgccgagcaattccttaaggacaacgagatcgccatcattggattc
ttcaaggacctggaatcggaggaggccaagaccttcaccaaagtcgccaacgccctggac
tcgttcgtctttggtgtgagcagcaatgccgatgtgattgccaagtacgaggctaaggac
aatggagtggttctgttcaagcccttcgacgacaagaagtccgtgttcgagggtgagctg
aacgaggaaaacctgaagaagttcgcccaggtgcagtctctgcccctgatcgttgacttc
aaccacgaatctgcttccaagatcttcggtggctcgatcaagtcgcatctgctgttcttc
gtgtccagggagggcggccacatcgagaagtacgtcgatcccctgaaggagatcgccaag
aagtaccgcgacgacatcctgttcgtgaccatctcgtccgacgaggaggaccatacccgc
atcttcgagttcttcggcatgaacaaggaggaggtgcccaccatccgtctgatcaagctg
gaagaggacatggccaagtacaagcccgaatcggacgatctgtccgccgagaccatcgag
gcgttccttaagaagttcctggacggcaagctgaagcaacacctcctttcccaggagctg
cccgaggattgggacaagaaccccgtcaaggtgctggtatccagcaacttcgagagcgtt
gccctggacaagagcaagagcgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggcccccatctacgaccagctggctgagaagtacaaggacaatgaggatatt
gtcattgccaagatggactccactgccaacgagctggagagcattaagatctcgtccttc
cccacaatcaaatacttccgcaaggaggacaacaaggtcatcgacttcaacctggacagg
actctcgatgatttcgtcaagttcctcgatgccaacggtgaggtggccgattccgagccc
gtcgaggagaccgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system