KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7023Help
Entry
Dmel_CG7023       CDS       T00030                                 

Gene name
CG7023, Usp12-46
Definition
Ubiquitin-specific protease 12/46 ortholog (EC:3.1.2.15)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG7023 (CG7023)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG7023 (CG7023)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:94C4-94C6
AA seq 424 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPSNGNPKATNQGGSTSAMASSIASKSSSTSNSNSNSNSTTNSNGNSS
NSTGSLNANTSVLDASGSLTATTTPIISGNGTGTNGANSEPTWVHEIFQGILTSETRCLN
CETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRV
KKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIH
CGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQS
RDCA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatgtgtcgcagctggagcgggagattggctccgatctgttcccaccgaat
gagcactacttcggtctggtgaactttgggaacacctgctacagcaactcggtgctgcag
gccctctacttttgcaagccattccgcgagaaggtccttgagtacaaggccaagaacaag
aggcccaaggagacgctgctgtcgtgtctggcggatctgttctacagcattgccacgcag
aagaagaaggtgggctcgattgcgcccaaaaagttcataaccaggctgcgaaaggagaag
gaggagttcgataactatatgcagcaggatgcccacgagttcctcaactttctgatcaat
cacatcaatgagatcatactggccgaacggaatgcagggcccagcaatgggaatcccaag
gccaccaatcaaggcggaagcacaagtgccatggccagcagcatagctagcaagtccagc
tcaacgtccaactcgaattccaactccaattcgacaacaaactcaaatggcaacagtagc
aattcgacgggatcactgaatgccaacacaagtgtgctggatgccagtggcagtcttacg
gccaccacaacacctataatctcaggaaacggaacgggaaccaatggggccaactcggag
cccacctgggtgcacgagatctttcagggcatacttacgtccgagaccaggtgcctcaac
tgcgagacggtgagcagcaaggacgagaatttcttcgatctccaggtggacgtggaccag
aacacctcgattacgcactgcctgcggtgcttcagcaacacggagaccctgtgctcggac
aacaagttcaagtgcgacaattgctgcagttatcaggaggcgcagaagaggatgcgtgta
aagaagttgcccatgatcctggccctgcatctcaagcgcttcaagtacatggagcagttt
aataggcacatcaaggtctcgcatcgcgttgtgtttccactggaactgaggctctttaac
acctccgatgatgcagtgaatcctgatcgtctctacgatctgaccgctgtggttatccac
tgcggttccggaccaaatcgtggccattatatatccattgtgaagagtcacggactgtgg
ctactattcgacgatgatatggtggacaaaatcgaggcttccacaatcgaggacttctat
ggtctgacctcggacatacacaagtcttcggagaccggctacatactgttctatcagtcg
cgggactgcgcctaa

DBGET integrated database retrieval system