KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7144Help
Entry
Dmel_CG7144       CDS       T00030                                 

Gene name
LKRSDH
Definition
(RefSeq) lysine ketoglutarate reductase/saccharopine dehydrogenase, isoform B
  KO
K14157  
alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Lysine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG7144 (LKRSDH)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.8  saccharopine dehydrogenase (NADP+, L-lysine-forming)
     Dmel_CG7144 (LKRSDH)
    1.5.1.9  saccharopine dehydrogenase (NAD+, L-glutamate-forming)
     Dmel_CG7144 (LKRSDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 928 aa AA seqDB search
MWRVIQLRATIAHPFTRQRHSRVIAIRREDQSVWERRAPFGPTHVQKLVKQNVKVIVQPS
NRRAYPMQAYMQAGAHIQEDISDASVIFGVKQVPIDALIPGKTYCFFSHTIKAQESNMPL
LDAILEKKIRLIDYERIIDERGARQVAFGKYAGVAGMVNILHGIGLRLLALGHHTPFMHI
GPAHNYRNSSMARQAIRDCGYEISLGMMPKSIGPLTFVFTGSGNVSQGAQEVFSELPIEY
VPPEMLRKVAEHGNQNKLYGCEVSRSDHLERREGGGFDAKEYDEFPERYISTFSTKIAPY
ASVIVNGIYWAVGSPKLISIPDAKNLLRPANTPWLPTSKGSPALPHRMLAICDISADPGG
SIEFMNECTTIDTPFCLYDADRNKDTKSFKGPGVLVCSIDNMPTQLPRESTDLFGELLAP
HVHDIIKSDAKKPLAEENFSYPIQSAIIASNGQLTEGFQYIQELRESQSHRSRHKMEGSS
ESDKKVLVLGAGMVSAPLVEWLHREKDVSITVCSQVKEEADRLAQQYAGVDSVYLDVNES
TGHLQELCGRADVVVSLLPYSLHGMVARYCVAEGTHMVTASYLNDEISGLHEEAKAKGVT
IMNEVGLDPGIDHLLALECIHEVQDKGAVVESFVSYCGGLPAPEHSNNALRYKFSWSPRG
VLLNTLSAAKYLSQGQIVEISGGGELMSSPRSLDFLPGFALEGFPNRDSTKYGNLYGLGR
DVHTLLRGTIRYKGFSESIKPMQLLGLIDPEPHALLHPSGPDVTWRQLVIHLMGMSDSTI
FYENLKQKLTERIGDVDGIESLGLLDDTPVVKLNTPLDTLSHYLSKRLAFERDERDLVVL
RHEVGIRWPDGRREERGINFVVYGQPQGHSAMAMTVGKPAAIAAKMILDGEIQERGVLLP
FTPDIYRPMLQRLRSEGLTATETSRWLN
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgagtgattcaactgcgcgcaacaatcgcgcatccgttcaccagacaacgtcat
agtcgagtgattgccattcggcgagaggatcagtcggtgtgggagcgacgagctccgttt
ggaccaacccacgtccagaagttggtcaagcagaatgtcaaggtcatagtgcagccgtcc
aatcgtcgtgcctaccccatgcaggcctacatgcaggctggagctcatattcaggaggac
atcagtgatgcttcggtgatattcggagtgaaacaggtgcccatagatgcactgattcct
gggaagacctactgcttcttttcgcacacgattaaagcgcaggaatcaaatatgccgctt
ttggatgctattttggagaagaaaattcggctcatcgactatgagcgaatcatcgacgaa
cgcggagcacgacaggtggcctttggcaaatatgccggagtggctggcatggtgaacatc
ctgcacggcattggactgcgtcttttggccctgggacatcatacaccattcatgcacatt
ggacccgctcataactatcgcaattcctcgatggctcgccaggcaatccgggattgtggc
tacgagatctcgcttggcatgatgcccaagtccattggaccacttacatttgtgttcact
ggctctggaaatgtttcccaaggtgcccaggaggtgttctccgagctgcccattgagtat
gttccaccggagatgctacgcaaggtggccgaacatggaaatcaaaataagctttacggc
tgcgaggtgagccgatcggatcatctggagcgtcgtgagggcggcggatttgatgccaag
gaatacgatgagttccccgaacgatacatctccacctttagcacgaagatagctccgtac
gcatcggttattgttaacggcatctactgggccgtaggcagtcccaagttgatcagcatt
ccggatgccaagaatctgctacgtccggcaaacactccctggctgccgacgagcaagggt
agtccggctttgccacatcgcatgctggccatttgcgacatttccgctgatcccggtggc
tccattgagtttatgaacgagtgcaccaccatcgacactccattctgcttgtacgatgcg
gacaggaataaggataccaagagctttaagggacccggagttttagtctgttcgattgat
aatatgcctacacaattgcccagagaatcgacggatttgtttggagagctgttggctcct
catgttcatgatattataaagagcgatgccaagaagccgttggcagaggagaacttctca
taccccattcagtcggctattatcgccagcaacggtcagctgacggagggcttccagtat
attcaggagctccgagagtcgcaaagccacagatcgcgccacaagatggagggaagttcg
gagtctgacaagaaggtcttggttctgggagctggcatggtgtccgctccactcgtagag
tggcttcatcgcgaaaaggacgtcagcataacggtttgctcgcaggtcaaggaggaagcc
gatcgcctggctcagcagtatgctggagtggacagcgtctatctggatgtgaacgagagc
actggtcatctgcaggagctgtgcggcagggcagatgtagtagtttccctgctgccctac
agtctccatggcatggtggcacgttattgcgtggcagagggcacccacatggttaccgca
agttatctgaacgacgagatctccggtttgcacgaggaggccaaggccaagggtgtgacc
atcatgaacgaggtgggcttggatcctggtatcgatcaccttctggcactggagtgcatc
cacgaggtgcaggacaagggagcagttgtcgagtccttcgtgagctattgtggcggtctg
cctgcaccggagcattccaataatgccctaagatataagttctcttggtcacccagggga
gtacttctcaacacactttccgctgcaaaatatctgagtcagggacaaattgtggagatt
tctggaggtggggaactcatgtcaagtcctcgcagcttggatttcctgccaggattcgcc
ctggagggtttccccaacagggattccaccaaatacggcaacctttacggcttaggcagg
gatgtgcacactttgcttcgtggaaccatacgttataagggcttttcggaatcgattaag
cctatgcagctcttgggacttatcgatccggagccacatgcattgctacatcccagtggg
ccggatgtcacgtggcgccagctggtgatccatctaatgggcatgtcggactcgaccatc
ttctacgagaacctcaagcagaagctgactgagcgcattggagatgtggacggcatcgag
agcttgggtctgctggatgatactcctgtggtgaagctcaacactccgctggatacgctt
agtcactatctctcgaagagacttgccttcgagcgggatgaacgcgacctggtggtgctg
cgccatgaagttggcatccgttggcccgatggtcgtcgtgaggagcgtggaatcaatttt
gtggtctacggacagccccagggtcactccgccatggcgatgactgtgggcaagccggct
gccatcgcagccaaaatgatcctagacggtgagatccaggaacgcggcgtcctgctgccc
ttcactcccgacatttatcgtcccatgctgcaacgtctgcgctccgagggtctgactgcc
acggaaacctccagatggctaaattaa

DBGET integrated database retrieval system