KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7171Help
Entry
Dmel_CG7171       CDS       T00030                                 

Gene name
Uro
Definition
Urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG7171 (Uro)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dmel_CG7171 (Uro)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dmel_CG7171 (Uro)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:28C3-28C3
AA seq 352 aa AA seqDB search
MFATPLRQPAAANHQTPKNSAGMDEHGKPYQYEITDHGYGKDAVKVLHVSRNGPVHAIQE
FEVGTHLKLYSKKDYYQGNNSDIVATDSQKNTVYLLAKKHGIESPEKFALLLARHFINKY
SHVEEAHVHVEAYPWQRVCQEETRTNVNGKCENGVQGNCDFSSIDNRSLHNHAFIFTPTA
LHYCDVVIRRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCS
WEYSDTENLDFLRAWQTVKNIIIRNFAGDPQVGVSSPSVQHTLYLSERQVLDVLPQVSVI
SMTMPNKHYFNFDTKPFQKIAPGDNNEVFIPVDKPHGTIYAQLARKNINSHL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacgcccctcagacagccagctgcggctaaccaccagaccccaaagaattcc
gccggcatggatgagcatggtaagccgtatcagtacgagattaccgatcacggatacggc
aaggatgcggtcaaggtgctgcatgtcagccgcaacggacccgtgcacgccatccaggaa
ttcgaggtgggcactcacctgaagttgtacagcaaaaaggattactaccagggcaacaac
tcggacatcgtggccaccgattcgcagaagaacaccgtctatttgctggcgaaaaagcat
ggcattgaaagtcccgagaagtttgctctgctcctggccaggcactttattaacaaatac
tcgcacgtggaggaggcgcacgttcatgtggaggcgtatccctggcagcgagtttgccag
gaggagaccaggaccaacgtcaatgggaagtgcgagaacggagtccaagggaactgcgac
ttcagctccattgacaacagatcactgcacaatcacgcttttatattcacgcccaccgct
cttcactactgcgatgtggttataaggagaacagatcccaaacaaacggtcatcacgggc
atcaagggtctccgggtgctgaagacgacccaatcctcgttcgtgaacttcgtgaacgat
gagttcagatctctgccagatcagtatgatcgcatctttagcaccgtggtggattgctcc
tgggagtactccgataccgagaacttggacttcctcagggcctggcaaacggtcaaaaac
ataatcattcgtaactttgctggcgatccgcaggtgggcgtgtcctcgccctccgttcag
cacaccctgtatctgagtgaaagacaggtcctggatgtcctgccgcaggtgtcggtcatt
tcgatgaccatgccaaacaagcactacttcaacttcgatacgaagcccttccagaagatt
gcacccggcgacaacaatgaagttttcatcccagtggacaagccacatggcaccatctat
gcccaattggcccggaagaacatcaatagtcacctgtag

DBGET integrated database retrieval system