KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7356Help
Entry
Dmel_CG7356       CDS       T00030                                 

Gene name
Tg
Definition
Transglutaminase (EC:2.3.2.13)
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dmel_CG7356 (Tg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:28D3-28D3
AA seq 776 aa AA seqDB search
MGQKLSCCQKCGDWKWCTSKDNEESTLRIRNANANYFTGIPQGDKTDGASSAVLGVLKVD
LCLEDNHEEHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTK
PSPGHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTK
LLGDGSRSYPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVW
KIGQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFS
GGVAPTKWTGSVEILQQFYKTQKSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDT
QASLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQ
EASDNMYRVGPASVAAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLA
IGHLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNDIEF
DMELKDDIKIGQSFSVVLKVSNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELE
PKSSDYVRMEVIFEEYYDKLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGE
AAIVAQKELDVILRLENPLPIPLHKGVFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTP
PYAGRGTMLAKFTSKELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaactatcgtgttgccaaaagtgcggcgattggaagtggtgtacatctaag
gacaacgaggagtcaacgctgcgtatacgcaatgccaatgccaactattttacgggcatt
ccacaaggcgacaaaacagatggcgccagctcagcagtattgggcgttttgaaggtcgat
ctgtgcctggaggacaaccatgaggagcaccatacgagtcacttctatgcggcagctgcc
aaggaagcgttggtcgtgcgacgaggagaacccttccggctgaagatccacttcaatcga
gactacagtcccagcaaggatgccatcagtttcattttcacagtagcggatgacaccaag
ccgagtcccggtcatggaacactcaatgccctggtgccgcacgatggcatcgattatctg
ggcgacactttggaatggggagccggcatcgaatcgcatgagggtcaaacgcttacggtg
ctaatcaagccaccatccacctgtcccgtaacggaatggaaactggacatcgacacgaag
ctgctgggcgatggatcgcgaagctatcccctgccgttgcccatctatgtactctttaat
ccctggtgtccggatgatcaggtgtatctggaggatcgtgatcagcgcaaggagtacgtg
atgcacgataccacgctcatctggaggggatcgtacaacagattgcgtccatcggtttgg
aaaatcgggcaattcgaacgacatgtgctcgagtgcagcctaaaggtattgggtacggtg
ggcaggattccgccagcctacagaggcgatcccgtgagagttgctcgcgccttgtccgca
ctggtgaattcggtggatgatgacggtgttttgctgggcaactggtcagaggacttctcc
ggcggcgtggcacccaccaagtggactgggtccgtggagattcttcagcaattctacaag
acccagaagtcggtgaagtttgcacagtgctggaatttcagcggtgttctgaccaccatt
gccaggagtctgggaataccgtctaggatcatcacttgctactcctccgcccacgataca
caggcctcactcaccgtggacgtgttcatcgacgcgaacaacaagaagttggatgcagag
accacggactcgatctggaactatcacgtgtggaatgagctctggatgcagagaccggat
ttgggcgtgggtgagcacgggaccttcgatggctggcaggtggtggacgccactccgcag
gaggcctccgataatatgtatcgcgtgggacccgcctccgttgcggcggtgaaaaacggt
gacatcttgcgaccattcgatggtggtttcgtcttcgcggaggtgaatgcggataagctc
tattggcgctacaatggacccagccagccgcttaagctgctcaggaaggatacgctggcc
atagggcatctcatcagcacgaaagcggtactcaaatgggaaagggaggacatcaccgat
acgtataagcatgccgagcgctccgaggaggagagaagcaccatgctcaaggccctcaag
caatcccgacatgcgttcagtagatactatctgaatgataatttcaatgatattgaattt
gatatggagctaaaggacgacattaagattgggcagagcttcagtgtggtcctgaaggtg
agcaacaagagcgagagtcgcacacacatggccacgggtcagatcagttgcgatgccgtg
ctctacacgggagtgggtgccgtggaggtgaagacactgggctttgaactggaattggag
cccaagagcagcgattacgttcgcatggaggtgatcttcgaggaatactacgataagttg
tcctcgcaggcggcattccagatctcggcggccgccaaggtcaaggacaccgactatgat
tactatgcccaggatgatttccgtgtgcgcaagccggacattaagttccagctgggtgag
gctgccattgtggcccagaaggagctggacgttattctgcgactggagaacccgctgccc
ataccgctgcacaagggtgtgttcacagtggagggtcctggcatcgagcagcctctcaag
ttcaagatcgctgaaattccagtgggtggcactgcggcggctaccttcaagtacactccg
ccctacgcggggcgtggcaccatgttagccaaattcacgtccaaggaactggacgatgtg
gatggctataggcactacgagattgagccacgaccggaggatctgctgcagccgaatgga
agccaccgaagcagcaacatcatacgcaggcgcaccgatgtaatagcttag

DBGET integrated database retrieval system