KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7391Help
Entry
Dmel_CG7391       CDS       T00030                                 

Gene name
Clk
Definition
(RefSeq) Clock
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG7391 (Clk)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG7391 (Clk)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dmel_CG7391 (Clk)
Chromosome [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dmel_CG7391 (Clk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:66A12-66A12
AA seq 1027 aa AA seqDB search
MDDESDDKDDTKSFLCRKSRNLSEKKRRDQFNSLVNDLSALISTSSRKMDKSTVLKSTIA
FLKNHNEATDRSKVFEIQQDWKPAFLSNDEYTHLMLESLDGFMMVFSSMGSIFYASESIT
SQLGYLPQDLYNMTIYDLAYEMDHEALLNIFMNPTPVIEPRQTDISSSNQITFYTHLRRG
GMEKVDANAYELVKFVGYFRNDTNTSTGSSSEVSNGSNGQPAVLPRIFQQNPNAEVDKKL
VFVGTGRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSG
YDYYHFDDLDSIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYYVSYHQFNSKPDYV
VCTHKVVSYAEVLKDSRKEGQKSGNSNSITNNGSSKVIASTGTSSKSASATTTLRDFELS
SQNLDSTLLGNSLASLGTETAATSPAVDSSPMWSASAVQPSGSCQINPLKTSRPASSYGN
ISSTGISPKAKRKCYFYNNRGNDSDSTSMSTDSVTSRQSMMTHVSSQSQRQRSHHREHHR
ENHHNQSHHHMQQQQQHQNQQQQHQQHQQLQQQLQHTVGTPKMVPLLPIASTQIMAGNAC
QFPQPAYPLASPQLVAPTFLEPPQYLTAIPMQPVIAPFPVAPVLSPLPVQSQTDMLPDTV
VMTPTQSQLQDQLQRKHDELQKLILQQQNELRIVSEQLLLSRYTYLQPMMSMGFAPGNMT
AAAVGNLGASGQRGLNFTGSNAVQPQFNQYGFALNSEQMLNQQDQQMMMQQQQNLHTQHQ
HNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQLQQQ
NDILLREDIDDIDAFLNLSPLHSLGSQSTINPFNSSSNNNNQSYNGGSNLNNGNQNNNNR
SSNPPQNNNEDSLLSCMQMATESSPSINFHMGISDDGSETQSEDNKMMHTSGSNLVQQQQ
QQQQQQQILQQHQQQSNSFFSSNPFLNSQNQNQNQLPNDLEILPYQMSQEQSQNLFNSPH
TAPGSSQ
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgacaaggatgatacaaaaagcttcctttgcaggaaatcgcgt
aatctcagcgagaagaagcgacgagatcagttcaactcgctggtcaacgatctcagcgcc
ttgatatccacatccagcagaaagatggataagtccacggtcctgaagtccacgatagcc
ttcctgaaaaatcataatgaggccaccgatcgctccaaggttttcgaaatacaacaggac
tggaagcctgcgttcctcagcaatgacgaatacactcacctcatgctggagtctctcgat
ggttttatgatggtcttcagcagcatgggctccatcttttacgcctcggaaagtattacc
tcccagctgggctatctgccgcaagatttgtacaacatgaccatttatgacctggcctat
gagatggaccatgaggcgctgctgaatatctttatgaatcccacaccggtaatcgagccc
agacagacggacataagttccagtaaccagatcacattctacactcatttgagacgcggc
gggatggagaaagtggatgccaatgcctacgagttggtcaaattcgtgggctactttcgt
aacgataccaatacttcgacgggttccagttcggaggtttcgaatggctcaaatggacaa
cctgcggtgctgccgcgcatcttccagcagaatcccaatgccgaggtggacaaaaagctg
gttttcgtgggcactggacgcgtacagaatccccaactgatcagggaaatgagcattatt
gatcccacaagtaatgagttcacttcgaaacacagcatggagtggaagtttttgtttctg
gatcaccgtgctcctccgatcattggctatatgcccttcgaggttctggggacgtccggc
tatgattattaccactttgatgatctggacagtattgtggcgtgccatgaagagctaagg
caaacgggtgagggcaagtcttgctactaccgattccttacgaagggccaacagtggata
tggttgcaaacggactactatgtgagctatcaccagttcaattccaaaccagactacgtg
gtctgcacccataaggttgtcagctatgccgaggttctgaaggatagtcgaaaggagggc
caaaaatcgggaaatagcaacagcatcaccaacaatgggagcagtaaggtcatagcctcc
acgggaactagcagcaaatccgcatctgccaccacaacactgagggacttcgagctgagc
agccaaaatctggatagcacattgctcggaaatagtctggccagtttgggcactgaaaca
gcagccacttcacccgccgtggactcgtcgcccatgtggtcagcgtcggctgtccaaccg
tcgggatcatgccaaataaatcccctgaagacatcgcgtcccgcttcgagttatggcaat
atcagctccacaggaatatcgccgaaggccaaacgaaagtgctacttctacaacaaccgg
gggaatgactcggattcaacgtccatgtcgacggattcggtcaccagccggcagtccatg
atgacgcacgtcagttcgcaaagccaacggcagcgatcgcatcaccgagaacaccatcga
gaaaatcatcacaatcagtcacatcatcacatgcagcaacagcagcagcatcagaaccag
cagcagcaacatcagcagcaccagcaactgcaacagcagctgcaacatacagtgggtact
ccgaaaatggtgcctctcctgccgattgcgtccacacaaataatggctggaaatgcgtgt
cagtttccccaacccgcctatccgcttgctagtccccaactggtggcaccgacatttctt
gagccgccgcaatatctcaccgccattcccatgcagccagtgatcgctccgtttccggtg
gcgccagtgctttccccacttccggtgcagtcacaaacggatatgctgcccgatacggtg
gttatgacgccaacacagagtcagttgcaggatcaattgcagcggaagcacgacgaactg
caaaaactgatcctccagcaacagaatgagctgaggatcgtatcagagcagctcctccta
tcccgctacacatatctgcagcccatgatgtcgatgggattcgcacctggcaacatgaca
gcagcagcggtgggtaatttgggagccagtggccaacgtggactgaatttcaccggcagc
aatgccgtgcagccgcaattcaatcagtatggatttgcactgaactcggagcagatgctt
aaccagcaggatcagcagatgatgatgcagcagcagcagaatctgcacacgcagcaccag
cacaatctccagcagcaacatcagagccactcacagttgcagcaacatacccagcagcaa
catcagcagcagcagcaacaacagcaacaacagcagcaacagcagcagcagcaacagcaa
caacagcagcagcaacaacagcagcaacagcagcagcaacagttgcagctgcaacaacaa
aatgatattttactgcgtgaggatatcgatgatatagacgcctttctcaatctgtccccc
ctgcactcattgggctcgcaatccaccattaatcccttcaactccagcagcaataacaac
aatcaaagctacaatggaggcagtaatctgaataatggcaaccagaacaacaacaatcgc
agttcaaatcctccgcaaaataataacgaggactcgctgttgtcctgcatgcagatggcc
accgaatcgagtccttcgatcaactttcacatgggcatcagcgatgatggctccgaaacg
cagagcgaggacaacaagatgatgcacacttccggcagcaatctggtgcagcagcaacag
cagcagcagcaacaacaacaaatcctgcagcagcatcaacagcagtcaaatagcttcttc
agttcgaatccctttctcaacagtcagaatcagaatcaaaaccaattgccaaacgatctg
gaaatattgccataccagatgtcccaagagcaatcacagaatctattcaactcgccacac
acagccccaggcagtagtcaatag

DBGET integrated database retrieval system