KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7393Help
Entry
Dmel_CG7393       CDS       T00030                                 

Gene name
p38b
Definition
CG7393 gene product from transcript CG7393-RA (EC:2.7.11.- 2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dme04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:34D1-34D1
AA seq 365 aa AA seqDB search
MSRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SAVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFKPTAAFAEL
LPKEQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaaaatggccaaattctacaagctggacatcaatcgcaccgagtgggaaatc
ccggaaacataccagaacctgcaacccgtgggtcagggtgcctacggccaggtctgcaag
gccgtggtccgcggaaccagcacgaaggtggccatcaagaagcttgccaggcccttccag
tcggcggtccatgcgaagcgcacctatcgggaactgcggctgctgaagcacatggatcac
gagaacgttattggtctgctggatgtctttcatccaggacagcccgccgattcgctggat
cagttccagcaagtgtacatggtgacccacttgatggacgccgatctgaacaacataata
cgcacgcagaaactgtctgatgatcatgtccagtttctggtctaccaaatcctgcgcggt
ctgaagtacatccacagcgctggggtcatccatcgtgatctaaagccatcgaacattgcg
gtaaacgaggactgtgagcttcgcatcctggatttcggtttggcccgtcccgcagaaagc
gagatgaccggatacgtcgcaacgcgatggtaccgggcgcctgagatcatgctcaactgg
atgcactacaaccagacggcggacatctggtcggtgggctgcatcatggctgagctgctg
actgggcgcacgctgttccctggaaccgatcacatccatcagctgaacctcatcatggaa
gtgctgggcacgccagctgatgagttcatgagccgcatctcctcggagagcgctagaaac
tatattcgttcactgccggtgatgccgcgccgcaatttccgcgacatcttccgcggtgcc
aatccgctggccatcgatttgctggagaagatgctggaacttgacgccgacaagcgcata
accgccgagcaggcgctggcccatccgtacatggagaagtaccacgatccaaccgatgag
cagaccgccgcgctctacgaccagagcttcgaggagaacgagctgccggtggagaagtgg
cgggagatggtcttcagcgaggtgacggccttcaagcccacagccgccttcgctgagctc
ctgcccaaagagcagtaa

DBGET integrated database retrieval system