KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7405Help
Entry
Dmel_CG7405       CDS       T00030                                 

Gene name
CycH
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03022  Basal transcription factors
dme03420  Nucleotide excision repair
Module
dme_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dmel_CG7405 (CycH)
  Replication and repair
   03420 Nucleotide excision repair
    Dmel_CG7405 (CycH)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dmel_CG7405 (CycH)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dmel_CG7405 (CycH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C TFIIB Bcr-Abl_Oligo
Motif
Other DBs
NCBI-GeneID: 40429
NCBI-ProteinID: NP_524207
FlyBase: FBgn0022936
UniProt: O76513
Position
3L
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQY
EIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP
DRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctcgcaaaagaggtcctggacattcgccaatgagggccagctcatg
gagttccgcgtggagcagaacagcaagtacatcgagtcgcacgaggaggaggcgcagggt
cgcgacctcaatgagcactttctcacgtcggcggaggagcgcctgttgctgaagcagtac
gagatctacctgttcgatttctgccgccgcttcgaaccgacgatgcccaagtgcgttgtg
ggcacggccttccactacttcaagcggttctatctgaacaactcccccatggactatcac
cccaaggagattctagccacatgcgtgttcgttgcctgcaaagttgaggagttcaacgtg
tccatcaaccagttcgtaaacaacatcaagggcgacaggaacaaggccaccgacatagtg
ttgtccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgagggtttcctgatagatataaaaactcgcagcaatatgcagaatcca
gatcgtctgcggccacatattgatagtttcattgattccacgtactactcggatgcctgt
cttctgcatacgccttcgcaaattgcattggctgccgtcctccacgcggccagcagagag
caagagaatctcgatagctatgtgacggatcttctgtttgtctccgccagggagaagcta
cccggactcatagatgccgtgcgaaaaattcgcataatggtgaagcaatatcagcagccc
gatcgggagaaggtcaaggccatcgagaaaaagttggacaagtgccgaaatcaagccaat
aatcctgatagcgaactctataaggagcgcctacgccgattgtacaccgatgaggatgac
atgcccgccgaagatgcctcattccacattgcagatgtgagctcggacacatctgctatg
aacatcagccaatag

DBGET integrated database retrieval system