KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7405Help
Entry
Dmel_CG7405       CDS       T00030                                 

Gene name
CycH
Definition
Cyclin H (EC:2.7.1.- 2.7.11.22 2.7.11.23)
Orthology
K06634  
cyclin H
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dmel_CG7405 (CycH)
  Replication and repair
   03420 Nucleotide excision repair
    Dmel_CG7405 (CycH)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dmel_CG7405 (CycH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:78F3-78F3
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQY
EIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP
DRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctcgcaaaagaggtcctggacattcgccaatgagggccagctcatg
gagttccgcgtggagcagaacagcaagtacatcgagtcgcacgaggaggaggcgcagggt
cgcgacctcaatgagcactttctcacgtcggcggaggagcgcctgttgctgaagcagtac
gagatctacctgttcgatttctgccgccgcttcgaaccgacgatgcccaagtgcgttgtg
ggcacggccttccactacttcaagcggttctatctgaacaactcccccatggactatcac
cccaaggagattctagccacatgcgtgttcgttgcctgcaaagttgaggagttcaacgtg
tccatcaaccagttcgtaaacaacatcaagggcgacaggaacaaggccaccgacatagtg
ttgtccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgagggtttcctgatagatataaaaactcgcagcaatatgcagaatcca
gatcgtctgcggccacatattgatagtttcattgattccacgtactactcggatgcctgt
cttctgcatacgccttcgcaaattgcattggctgccgtcctccacgcggccagcagagag
caagagaatctcgatagctatgtgacggatcttctgtttgtctccgccagggagaagcta
cccggactcatagatgccgtgcgaaaaattcgcataatggtgaagcaatatcagcagccc
gatcgggagaaggtcaaggccatcgagaaaaagttggacaagtgccgaaatcaagccaat
aatcctgatagcgaactctataaggagcgcctacgccgattgtacaccgatgaggatgac
atgcccgccgaagatgcctcattccacattgcagatgtgagctcggacacatctgctatg
aacatcagccaatag

DBGET integrated database retrieval system