KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7471Help
Entry
Dmel_CG7471       CDS       T00030                                 

Gene name
HDAC1
Definition
(RefSeq) Histone deacetylase 1 (EC:3.5.1.98)
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Longevity regulating pathway - multiple species
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dmel_CG7471 (HDAC1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG7471 (HDAC1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmel_CG7471 (HDAC1)
Chromosome [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Dmel_CG7471 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     Dmel_CG7471 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dmel_CG7471 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    Dmel_CG7471 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:64B12-64B12
AA seq 521 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcacagcaaaaagcgcgtttgttactactacgacagcgacattggcaactac
tactatggccagggtcatcccatgaagccccatcgcatacgcatgacccacaacctgctg
ctcaactatgggctctatcgaaaaatggaaatataccgtccccataaagccactgccgat
gagatgaccaagttccactcggacgagtacgtccggttcttgcgatccattcggccggac
aacatgtcggagtacaacaagcagatgcagcgtttcaatgtcggcgaagattgtcccgtc
ttcgatggactatacgagttttgccaactctccgccggaggatccgtagctgcggccgta
aaactgaataagcaagcctcggagatctgcatcaattggggcggtgggctgcatcacgcc
aaaaaatcggaagcctcgggcttctgctacgtcaacgacattgttctgggaattctggaa
ctgcttaaataccatcagcgtgttctctacatagatatagacgtccatcacggcgatggc
gtggaggaggcgttctataccaccgatcgtgtgatgactgtcagcttccacaagtacgga
gagtatttcccgggcactggcgatctgcgagacattggcgccggcaagggaaagtactat
gcggtgaatatacccctgcgtgatggcatggatgatgatgcgtacgagagcatatttgtg
cccattatcagcaaggtgatggaaacattccagccggcagccgtggtgttgcagtgtggc
gccgattcgctgactggcgatcggttaggctgcttcaatctcaccgtcaagggtcacggc
aagtgcgtggagttcgtgaagaaatataacctgccattcctgatggtcggcggtggtggt
tataccattcgtaatgtatcccgctgctggacctatgagacctccgttgcactggccgtg
gagatagccaacgaactgccctacaacgattacttcgagtactttgggcccgattttaag
ctgcacattagtcccagcaatatgacgaatcagaatacatccgagtacctggagaagatc
aagaaccgtctgttcgagaacctgcgcatgctgcctcacgctccgggcgttcaaatccaa
gcgattcccgaggatgccatcaacgatgagtccgacgacgaggacaaggtcgacaaggat
gatcgcctgccgcagagcgacaaggacaagcgcattgtgcccgagaacgagtactccgat
tcggaggatgagggcgaaggcggtcgcagggataaccgttcgtacaagggtcagcggaag
cggccgcgtctcgacaaggacaccaacagcaacaaggcatcctcagagacgtccagcgag
atcaaggacgaaaaggaaaagggcgacggagctgatggcgaggaatcgacggcgtctaat
accaatagcaacaacaacagtaacaacaagagcgataatgatgccggagcgacagctaat
gccggatccggttcgggatcaggttccggtgccggggccaagggcgccaaggagaacaac
atttga

DBGET integrated database retrieval system