KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7562Help
Entry
Dmel_CG7562       CDS       T00030                                 

Gene name
Trf
Definition
(RefSeq) TBP-related factor
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dmel_CG7562 (Trf)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    Dmel_CG7562 (Trf)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     Dmel_CG7562 (Trf)
  RNA polymerase III system
    TFIIIB
     Dmel_CG7562 (Trf)
  RNA polymerase I system
    SL1/TIF-1B
     Dmel_CG7562 (Trf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBP DUF3378
Motif
Other DBs
NCBI-GeneID: 34102
NCBI-ProteinID: NP_476939
FlyBase: FBgn0010287
UniProt: Q27896
Position
2L
AA seq 224 aa AA seqDB search
MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIRLQNIVATFSV
NCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGS
RKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYR
MVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRKT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttcactttaaagtcgcggacgctgaaagggacagggataatgtggctgcgacc
agcaatgctgccgccaatccgcacgcagccctgcagccgcaacagcccgttgccctggtg
gagcccaaggatgcacaacatgagatacgattgcagaatatcgtggccaccttctcggtg
aactgtgaactggacctcaaggcaatcaactcgcgtacgaggaactcggagtactcgccc
aagcgctttcgtggcgtcatcatgcgaatgcactcgcccaggtgcacagcgctaatcttt
cgaacgggcaaggtcatctgcacgggtgcacgaaacgagattgaggcggacattggatcg
cgaaagttcgcacgcatcctgcagaagctgggattccccgtaaagttcatggaatacaag
ctgcagaatattgtggccaccgttgatctgcgcttccccatccgcctggagaacctcaac
cacgtgcacgggcagtttagttcctacgaaccggagatgtttccaggcctaatctatcgc
atggtcaagccgcgcatcgttctcctgatcttcgtcaacggaaaggttgtatttacgggc
gccaagtcgcgcaaggacattatggactgcctggaggcgatatcacctattttactaagt
tttcgcaagacgtag

DBGET integrated database retrieval system